KEGG   Clavibacter michiganensis subsp. sepedonicus: CMS1932Help
Entry
CMS1932           CDS       T00678                                 

Definition
(GenBank) putative aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
cms  Clavibacter michiganensis subsp. sepedonicus
Pathway
cms00260  Glycine, serine and threonine metabolism
cms01100  Metabolic pathways
cms01110  Biosynthesis of secondary metabolites
cms01120  Microbial metabolism in diverse environments
cms01130  Biosynthesis of antibiotics
cms01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cms00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CMS1932
Enzymes [BR:cms01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     CMS1932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5 GATase_6
Motif
Other DBs
NCBI-ProteinID: CAQ02034
UniProt: B0REE2
Position
2046393..2047496
Genome map
AA seq 367 aa AA seqDB search
MDTVTDAASPVSPLRLHDTAARGFASDNYSGIHPEVLAAIAAANDGHQVAYGGDAYTARL
QEVVGEHFGRGAEAFPVFNGTGANVTGLLSMLPRWGAVICATTAHINTDEGGAPERVAGI
KLLQVPTEDGKLTPELIDREAWGWGDEHRAQPLAVSITQTTELGTVYTPAEVRAIADHAH
ERGMRLHMDGARLSNAAATLDAPFRAFTSDAGVDVVSFGGTKNGLLYGEAIVVLDPEASE
GLTYLRKLNMQLASKMRFVSAQLLALLGSEVDGVPLYLRSARHANGMAARLRAALEGVDG
VEFTQETQANGLFAILPEGVADRLRGEFRFYDWDPARREVRWMCSFDTTEDDIDRFATAI
RREVGAG
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggacaccgtgaccgacgccgcctcccccgtctcccccctccgcctccacgacaccgcc
gcccgcgggttcgcctccgacaactactccgggatccaccccgaggtgctcgcggccatc
gcggccgcgaacgacgggcaccaggtcgcgtacggtggcgacgcctacacggcccgcctg
caggaggtcgtcggcgagcacttcggccgcggcgccgaggcgttccccgtcttcaacggc
acgggcgcgaacgtcaccggactcttgtcgatgctgccgcgctggggtgccgtgatctgc
gcgaccacggcccacatcaacaccgacgagggcggcgcccccgagcgcgtcgccggcatc
aagctcctccaggtgcccaccgaggacggcaagctgacgcccgagctcatcgaccgcgag
gcgtggggctggggggacgagcaccgcgcgcagccgctcgccgtgagcatcacgcagacc
accgagctcggcaccgtctacacgccggccgaggtgcgggcgatcgccgaccatgcgcac
gagcgcggcatgcgcctgcacatggacggtgcgcgcctgtcgaacgccgccgccacgctg
gacgcacccttccgcgcgttcacgtcggacgcgggcgtcgacgtcgtcagcttcggcggc
accaagaacggcctgctctacggcgaggcgatcgtggtgctcgaccccgaggcgtccgag
ggactcacctacctgcgcaagctcaacatgcagctcgcgtcgaagatgcggttcgtgagc
gcgcagctgctggcgctgctcggatccgaggtcgacggcgtgccgctgtacctccgctcc
gcgcgccacgcgaacggcatggccgcgcgcctccgggccgcgctcgagggcgtcgacggc
gtggagttcacgcaggagacgcaagcgaacggcctgttcgcgatcctccccgagggcgtc
gccgaccgcctccgcggcgagttccgcttctacgactgggatccggcccgccgcgaggtg
cgctggatgtgctccttcgacaccaccgaggacgacatcgaccgcttcgccacggcgatc
cgccgggaggtcggggcggggtag

DBGET integrated database retrieval system