KEGG   Clavibacter michiganensis subsp. sepedonicus: CMS2430Help
Entry
CMS2430           CDS       T00678                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
cms  Clavibacter michiganensis subsp. sepedonicus
Brite
KEGG Orthology (KO) [BR:cms00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CMS2430
Enzymes [BR:cms01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     CMS2430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: CAQ02510
UniProt: B0RH34
Position
complement(2572196..2573122)
Genome map
AA seq 308 aa AA seqDB search
MYSGCPDYIPHPWSPVTLRLMAVHAHPDDESSKGAATYTHYTKQGAEIMVVSCTGGEAGD
ILNEGLAERAMAERDLPGLRRIEMARAQAVMGVQHRWLGYVDSGMAREDGSLPPAAFASI
PVEVSAEPLVRLVREFRPHVLVAYDENGGYPHPDHIQAHVIAMEAWRESGVAGSYPDAGE
PWEISKLYFDRIFNGAKIRAVREHLVAADAAPEMLEAVDEMLDWMGDRPDLATTHVHVAD
HFEARDRALLSHASQVAPDSSFFRWPRDLQQRAWPFEDFQLVESRVDAPDEEHDLFAGIV
DEDQAAVA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
ttgtactctgggtgtccagactacattccccacccttggagccccgtgaccctgcgcctc
atggccgtgcacgcccaccccgacgacgagtccagcaagggcgcggcgacgtacacccac
tacacgaagcagggcgccgagatcatggtcgtcagctgcacgggcggcgaggccggcgac
atcctcaacgaggggctcgccgagcgcgcgatggccgagcgtgacctgccggggctccgc
cgcatcgagatggcgcgcgcgcaggccgtcatgggcgtccagcaccgctggctcggctac
gtcgactcgggcatggcgcgcgaggacggctcgctgccgcccgcggctttcgcgagcatc
ccggtggaggtgtcggccgagccgctcgtccgcctggtgcgcgagttccgcccgcacgtc
ctcgtggcgtacgacgagaacggcggctacccgcaccccgaccacatccaggcgcacgtc
atcgcgatggaggcgtggcgcgagtccggagtcgcgggctcctaccccgacgcgggcgag
ccgtgggagatctcgaagctctacttcgaccggatcttcaacggcgccaagatccgcgcc
gtgcgcgagcacctggtcgccgccgacgcggcccccgagatgctcgaggccgtcgacgag
atgctcgactggatgggggaccgtcccgacctcgcgaccacgcacgtccacgtcgccgac
cacttcgaggcgcgcgaccgcgcgctgctctcgcacgcgagccaggtggcgcccgacagc
tcgttcttccgctggccgcgcgacctgcagcagcgggcgtggccgttcgaggacttccag
ctcgtggagtcgcgcgtcgacgcgcccgacgaggagcacgacctcttcgccgggatcgtc
gacgaggaccaggcggccgtcgcgtga

DBGET integrated database retrieval system