KEGG   Cordyceps militaris: CCM_00011Help
Entry
CCM_00011         CDS       T03108                                 

Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cmt  Cordyceps militaris
Pathway
cmt00450  Selenocompound metabolism
cmt00970  Aminoacyl-tRNA biosynthesis
cmt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CCM_00011
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CCM_00011
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cmt01007]
    CCM_00011
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cmt03016]
    CCM_00011
Enzymes [BR:cmt01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CCM_00011
Amino acid related enzymes [BR:cmt01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CCM_00011
Transfer RNA biogenesis [BR:cmt03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CCM_00011
 Prokaryotic type
   Other AARSs
    CCM_00011
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1 tRNA-synt_1e KilA-N
Motif
Other DBs
NCBI-GeneID: 18162046
NCBI-ProteinID: XP_006665234
UniProt: G3J6C1
Position
Unknown
AA seq 660 aa AA seqDB search
MASATTPILPAEGKRNVLITSALPYSNNLPHLGNVIGSVLSADLYARYCRARGYQTLYVC
GTDQYGTATETKALEEGTDPASLCAKYHALHKSIYDWFRIDFDIFDKTPTQHQTDIVQDI
FTKLWKNGYIYEDETIQPFCPVESHNTFLADRFVEGECSICGDKGARGDQCDACGSILDP
LKPEETGAVDGDAAIEVKATGWLVNPRCKVDGTAPEARKTKHLYLKLDDISEELKAWYKT
TADNGWSTNAKAITQSWIDKGLKPRAISRDLKWGVPIPAVEGLNVEDYARKVFYVWFDAC
IGYISITKTYTDGDNRDGKNWEKWWKNPENVELMQFQGKDNVGFHSIVFPSSLLGTKENW
TKVTRISATEYLNYEQGKFSKSRGIGVFGNNAKDTGIDPDIWRFYLLSRRPELADSEFKW
EEFIDVNNNELLKNVGNFIQRTLKFCVAKMDSTVPAATVSNDVIESHKQSANQILASYIE
HQEANKMRIGISDILTFSALGNKFLQDNGLNNKLLAEEPELCNTVINVAINHVHLLAGLL
YPYMPTTAESIFQQLGQEPNPFIPDVFGFTAVPVGHKIGTPGPLFSVIPAAKLDEWRDAY
GGAELKKQKAIEAEKAAAKKAKKLADKEKKKAKKAETADLKTEGASTAADISKLSLEEKK
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcgccaccacgcccatccttcccgctgagggcaagcgcaacgtcttgatcacc
agcgctctcccctactccaacaacctgccacacttgggcaacgtcattggcagtgttctg
tcagccgacttgtacgcccgatactgcagagccagaggataccagactctgtacgtttgc
ggcactgatcaatacggcaccgctaccgaaacaaaggccctcgaggaaggcaccgaccct
gcttccctttgcgccaagtaccatgcccttcacaagtccatctacgactggttccgcatt
gatttcgatattttcgacaagacgccgacgcaacaccagaccgacatcgtacaagacatc
tttaccaagctttggaagaatggctacatttacgaagatgagaccattcagccgttttgt
cccgtagagtcccacaatactttccttgccgaccgtttcgtcgagggcgaatgctccatc
tgtggtgacaagggcgcccgtggcgaccagtgcgacgcctgcggctctattctcgatcct
ctcaagcccgaagaaacgggagccgtcgacggagacgcggccattgaagtcaaggctacc
ggctggctggtcaacccccgctgcaaggtcgacggcacagctcccgaagcccgcaagacg
aagcacctttatctgaagctcgatgacatctcggaggagctgaaagcttggtacaagacc
accgccgataacggctggagcacaaacgccaaagccattacccaatcttggattgacaag
ggtctcaagcctcgtgccatctcccgagatctgaagtggggtgtcccaatccctgctgta
gaaggcttaaacgttgaagactatgctcgcaaggtcttttacgtctggttcgatgcctgc
attggctacatatccatcaccaagacttatactgatggtgacaaccgagacggcaagaac
tgggagaagtggtggaagaaccccgagaacgtcgagcttatgcaattccagggtaaggat
aacgttggtttccacagcatcgttttcccttcttctttgcttggtaccaaggagaactgg
accaaggtaaccagaatctccgctacggagtacctcaactacgaacaggggaagttctcc
aagtctcgcggtatcggcgtgtttggcaacaacgccaaggatactggcattgaccctgac
atctggcgattctatctgctctctcgccgtcccgaactggcagattcggaattcaagtgg
gaagaattcattgatgtcaacaacaacgaattgctcaagaatgttggcaatttcatccag
cgtaccctgaaattctgtgtggctaagatggatagcactgtccccgccgctaccgtcagc
aacgatgttatcgagtcgcacaagcagtcagctaatcagatacttgcctcatacattgaa
catcaggaggccaacaagatgcgcattggtatttccgatattctcaccttttcagctctc
ggaaacaagttccttcaggacaatggcttgaacaacaagctcttggctgaggaaccggaa
ctttgcaacacagttatcaatgttgccatcaaccatgtgcacctcttggccggcctgctc
tacccttatatgcccactacggctgaatccatcttccagcagcttggtcaggagccaaac
ccattcattcccgatgtctttggctttaccgccgtccctgttggtcacaagattggcacc
cctggtcctctcttctccgtcattcctgctgccaagctcgatgagtggcgcgatgcctac
ggtggcgcagagctgaagaaacaaaaggccattgaggcggagaaggccgcggcgaagaag
gcgaagaagcttgctgataaggagaagaagaaggccaagaaggctgagaccgcagatttg
aagacggaaggtgcttccactgctgcggatatttcgaagctatctttggaggaaaagaaa
taa

DBGET integrated database retrieval system