KEGG   Cordyceps militaris: CCM_01501Help
Entry
CCM_01501         CDS       T03108                                 

Definition
(RefSeq) glutathione synthetase large chain
  KO
K21456  glutathione synthase [EC:6.3.2.3]
Organism
cmt  Cordyceps militaris
Pathway
cmt00270  Cysteine and methionine metabolism
cmt00480  Glutathione metabolism
cmt01100  Metabolic pathways
Module
cmt_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:cmt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CCM_01501
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CCM_01501
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmt04147]
    CCM_01501
Enzymes [BR:cmt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     CCM_01501
Exosome [BR:cmt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CCM_01501
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSH_synth_ATP GSH_synthase
Motif
Other DBs
NCBI-GeneID: 18163532
NCBI-ProteinID: XP_006666720
UniProt: G3J5D3
Position
Unknown
AA seq 501 aa AA seqDB search
MAGITSAAYPPSLSEAETEVLVNTIKDWSAGNGLVVRPPPTVIPAEVDPKGIAAINAPVT
LFPSPFPRQCFAQALGVQTTYNELYAAVSRNEEFIEGTVKEYAQQRRVHGCPGALVIEGD
EFIKNLWAVHQKVKAEGYTQDTTADSPTFQVKQVEFNTIAASFGGLSYYTSRLHKYLSTR
EYPLLEKAIPSDAMELPSNNSIPGLAAGLETAFYAYPASELGHPNCILFLVQDGERNVFD
QRHIEYRLADVAPAVPVFRLAFSAIKKHTAIADTPKRQLLYHPPQCPDKTYEVAVAYLRG
MYDPSDFPDQDAWDARYHIERSAAIKCPTVLTQLAGTKKVQQVLATPQPASAPPSVLHRF
VKDAAADQVAALARTFTNIYPMDTSPAGLEARRRVLDPQLAEAGAIPAYLKSIPEAHWNS
YILMELITPPPVSNLILRNGSVEKGGVICELGIYGTCLWDQQTDEIHHNEQAGYLLRTKG
DKSEEGGVAAGFGCMDSCRLV
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggccggcatcaccagcgcggcgtacccgccatcgctctccgaggccgagacggaggtc
ctcgtcaacaccatcaaagactggtccgcgggcaatggcttggtggttcgaccgccgccg
actgtgatcccggcagaagtcgaccccaagggcatcgctgccatcaatgcgccggtgacg
ctgttccccagtccctttccccggcagtgctttgcccaggctctcggtgtgcagactacc
tacaatgagctgtacgccgctgtaagcagaaacgaggagtttatcgaaggcaccgtcaaa
gagtacgcacaacaacgtcgagtacatggttgccccggagctctagtcattgaaggagac
gagttcatcaagaacttgtgggctgtgcaccaaaaggtcaaggctgagggatacacacag
gacactacggcggactcgccgacatttcaggtcaagcaagtcgaattcaatacgattgcc
gcctcattcggcggactctcatactacacatcccgcctacacaaatatctttccacgagg
gagtacccgctcttggagaaggccattccgagtgacgcgatggagctcccctcaaacaac
agcatcccgggtctggccgctggattagaaacggcattctacgcataccctgcctctgag
ctcggccaccctaactgcattctgttcctggtgcaggacggcgagcgcaacgttttcgac
cagcgccacattgaataccgtctcgccgacgtcgcgcccgccgtgcccgtcttccgcctc
gccttctccgccatcaagaagcacacggccattgccgacacgcccaagcggcagctcctg
taccacccgccgcagtgcccggacaagacgtacgaggtcgccgtcgcgtacctgcgcggc
atgtacgaccccagcgacttcccggaccaggacgcgtgggacgcgcgctaccacattgag
cgctcggcggccatcaagtgcccgacggtgctgacgcagctggcgggcacgaaaaaggtc
cagcaggtgctggccacgccgcagcccgcgtccgcgccgccgtcggtcctccaccggttc
gtcaaggacgccgccgccgaccaggtcgccgcgctggcgcgcacctttaccaacatttac
cccatggacacgtcgcccgccggcctcgaggcgcgccgcagggtgctcgacccccagctg
gccgaggcaggcgccatcccggcctacctgaagtcgatccccgaggcgcactggaactcg
tatatcttgatggagctcatcacgccgccgcctgtgtccaacctcatcttgcgtaacggc
agtgtggagaagggtggcgtcatctgcgagctcggcatttacgggacctgcttgtgggac
cagcagacggacgagattcatcacaatgagcaggcggggtacctgctgcgcacaaagggt
gacaagagcgaagagggcggcgtggcggctggttttggctgcatggacagctgccgtctt
gtttag

DBGET integrated database retrieval system