KEGG   Cordyceps militaris: CCM_01962Help
Entry
CCM_01962         CDS       T03108                                 

Definition
(RefSeq) H/K ATPase alpha subunit, putative
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
cmt  Cordyceps militaris
Brite
KEGG Orthology (KO) [BR:cmt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmt04147]
    CCM_01962
Enzymes [BR:cmt01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     CCM_01962
Exosome [BR:cmt04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CCM_01962
  Exosomal proteins of other body fluids (saliva and urine)
   CCM_01962
  Exosomal proteins of colorectal cancer cells
   CCM_01962
  Exosomal proteins of bladder cancer cells
   CCM_01962
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Hydrolase Cation_ATPase Cation_ATPase_N Hydrolase_3 DUF2231 HAD DUF1096
Motif
Other DBs
NCBI-GeneID: 18163991
NCBI-ProteinID: XP_006667179
UniProt: G3JBR7
Position
Unknown
AA seq 1414 aa AA seqDB search
MRKRFPVNQWCCDPRAPHPRRSPVYGSLVVFALLNGRCTDVICFLCVAATRDAVQFPVKQ
QLEAMNQLQTDTSLLYGSARHAKQDMLCRRTTHSNVFVYTPSASQPTTARMFLIKTNLEK
WIPPVYHRSEEGPSQHGREKKQARDCAPGRPLTSPCGLQVATTAPLVNPEHQQATWSPAR
ELRSKACPAPTSALSLAGISLIPSLCHQFVPNTWPLLSWDKSPPPLADRNTPPFLSSRGF
FFAFLASASLIRRPTNPSRADGGVRQFFLESFLLELCCRTAVFGSSVHAGVKLAAMPKLE
TSPPAWRLLSVALLSTPYHVSATERIRWHDEELGRQRTHSRPRLSRTNSTDSMAIRSISR
AQVDPAVTLPIHYRTVSFGIEESKGKERAEAIRAADATAKDLGDLEWHTIAADEVLSRLR
TSAQTGLSDEQVKRRQLEYGRNAPSPPKTNRTLTIFGYFFKGFGGILLVGSVLVFVSWKP
LGEPNPALANLALAIVLLAVFLLQASFNMFQDWSTSRVMASIKDMLPEQSQVLRDGKLAH
VPAEELVPGDVVYIKSGNKLPADLRLIQTSSDVKFDRSVLTGESRPVPGTVNFTDENYLE
THNLGLQGTHCIIGTSTGIVVATGDKTVFGRIATLTNEPKTQMTTLEREVLYFVLFICGI
MLTMITVVLVLWGAWLRKDHPDFISVSALIVSCVSVAVAFIPEGLPIAITAGLTITANLM
KKNDVLCKSLKTVETLGAVSVICSDKTGTLTQGKMSLTDCAIGSTNLSVEEFQAKLGNNE
KGGDSDVRSAFGQLGALAAICNAAELDASQADIPLAQRNVFGDATDTAILRFSESIADGN
VGYFRGCWQKVFDLAFNSKNKFMIRTFTCSRKEALGYTLHSSAASEFGDNDILLTIKGAP
DILIGRCSEYLSADGKVAPMDQNALATFEHLKQVYSSQGKRCLLLARKVVPGSSIKNAVE
DGAYEAEMSELAKSGLTLVGLVAIVDPLRPEIRDVVLTLRGAGIRIAMVTGDFSLTALAI
ARDAGIVTCVHVDNAGHLERNPDPASDSTDSEEKSSTGGSRGALVISGGELTLLNEHQWK
TLTEYDEIVFARTTPEQKLRIVREFQKDNVVAMTGDGVNDAPSLKAADVGIALGSGSDIA
MEAADMVLLDSFSSIVIAVQYGRVVFDNLKKVIAYLLPAGSFSEFWPVITNVAFGLPQIL
SSFLMIIICCFTDCVAATVLSYEKPEADVLHRRPRNVKKDRLVNWQLIFQAYGVIGMTET
LASFAMSYWYLERKGIAFKDLWFSFGKIPPYVTEEYYNARLTEASSIYFVNLVVMQWFNL
MAVRCRRLSIFQHPPAFNKATQNLYLFPAILFALSMAFLWCYPPAIQRVIVTAPVPVEYW
FLPFAFGIYIVFIDEVRRFFVRKYPSSLIAKAAW
NT seq 4245 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagcggttccctgtcaatcaatggtgctgcgatccgcgggcgccgcaccccagg
agaagcccagtctacggcagcttggttgtcttcgctctattgaacggaagatgcaccgac
gtcatatgctttttgtgtgtggccgccaccagggacgcagtccagtttcccgtcaagcaa
cagctggaggctatgaaccagcttcaaaccgatacgtcgctgctgtacggatcagctagg
catgcaaagcaagacatgctctgcaggaggacaacccattccaacgtctttgtttacact
ccttccgccagccagccaacgacagcgcgcatgtttctcattaagacgaacctggaaaaa
tggatccctcccgtttatcatcggtcggaagagggcccgagccagcatggacgagaaaaa
aaacaggctagggactgcgctccggggcggccgctgacgtcgccatgtggcttacaagtt
gccaccacagcacccctggtcaatccagagcaccagcaggctacatggtcccccgcgaga
gagctgcgctcaaaagcttgtccagccccgacatcagccctgtctctggctggtatatcg
ctcatacccagcctgtgccatcagttcgttcccaatacttggcctctgttatcctgggac
aaaagcccccctccacttgccgatcgaaatactccgccctttttatcctctcgtggcttt
ttttttgcctttttggcctcggcgtcactgatccgtcggccaacgaacccgtctcgcgct
gatgggggggtgaggcaatttttcctcgagtccttccttctagagttatgctgtcgcact
gccgtctttgggtcgtctgtacacgctggtgtgaagctagccgcgatgcccaaactggaa
acgtcgccgccagcctggcgtctgttgtccgtcgcgttgctgagcaccccataccacgtc
tctgccacggagcgtatccgctggcatgatgaggagctgggccgtcagcggacgcactcg
cgccctcgtctcagtcgcaccaattcgactgattcgatggctattcgcagcatttcgcga
gcgcaggtcgatccggccgtgactcttccaatccactaccgcactgtctcgtttggaatt
gaagagtccaaaggcaaggaacgtgccgaagctatccgggccgctgatgcaaccgccaaa
gatcttggtgacttggaatggcacacaatcgctgccgacgaggttttgtcgcgcctcaga
acctcggcccagactggtctctcggacgagcaagtcaaacgccgccagcttgaatacggt
cgcaacgctccctccccacccaagacgaaccgaaccttgacaatctttggctacttcttc
aaaggatttggtggcatccttttagttggcagcgtcctcgtattcgtgtcttggaaaccc
ctgggcgagccaaatcccgcacttgccaaccttgcccttgccattgttctcttggccgtc
ttcttgctccaggctagcttcaacatgttccaagactggtccacgtcccgtgtcatggcg
tcaattaaggatatgctacctgagcagtcacaagtgctgcgcgatggaaagctcgctcat
gttcccgccgaagagctagtccccggcgatgttgtctacatcaaatcaggcaacaagctc
ccggcagatctccgtctcatccaaacatcctcagatgtcaagtttgatcgctccgtttta
acgggcgagtcgcgtcctgtgccgggcaccgttaattttacggatgagaactacctcgag
acgcacaaccttgggcttcaaggaactcactgtatcattggtactagtactggtattgtg
gttgccactggcgataagaccgtctttggccgcatcgccaccctaaccaatgaacccaag
acacagatgacgactctggagagggaagtattgtactttgtcctcttcatctgcggtatc
atgcttaccatgatcactgttgtccttgtcctctggggtgcctggctgcgaaaggaccat
cctgatttcatctccgtcagtgccctcattgtcagctgcgtcagtgtcgctgttgcattt
atccccgagggtcttcccattgctattacagccggtctcaccatcactgccaatctaatg
aagaagaacgatgtactctgcaagtccctcaagactgtcgagacgttgggtgccgtatct
gtcatttgctcagacaagaccggcaccttgacgcagggtaaaatgtctcttactgactgc
gccattggtagcaccaatctcagcgtggaagaattccaggcgaaactgggaaacaatgaa
aaagggggcgactcagacgtacgctctgcgtttggtcagctgggggccctggctgctatt
tgcaatgctgctgagctcgatgcctcgcaggcagatattcccctggcccagcgcaacgtc
tttggcgacgcgacagacacggctatcctgcgattctctgagtctatcgctgatggcaac
gttggatacttccgaggttgctggcaaaaggtctttgatcttgctttcaacagcaaaaac
aaattcatgattcgcacgtttacctgcagccgcaaggaggccctgggatacacactgcat
tcatctgctgcttccgagtttggcgacaacgacattcttcttactatcaaaggcgcgcct
gacatcctcatcggccgatgctctgaatatctctccgctgatggcaaagtcgccccgatg
gatcaaaacgctctggccacgttcgagcacctcaagcaggtatactcgtcacagggtaaa
cgttgcttgcttcttgcgcggaaagttgtacccggcagtagcatcaaaaatgcagtcgag
gatggcgcctacgaggcggagatgtctgagcttgccaagtctggcctgacactcgtcggc
ctcgttgctattgtcgatcctctccggccggagattcgcgatgtagtgttgacacttcgt
ggtgctggtatcagaattgccatggttaccggcgactttagccttacggctcttgctatc
gcccgcgatgctggcatcgtcacctgtgtgcatgttgacaacgccggccacctggagcgt
aaccctgatccggcctcggactctactgactctgaagaaaagagcagcaccggtggttcg
cgcggtgcgctcgttattagtggcggcgagctgacgctactcaacgaacaccagtggaag
acactcaccgagtacgatgagattgtgtttgcgcgcacgaccccagagcagaagttgcgc
atcgtgcgcgagttccagaaagacaatgtagtagctatgactggcgacggtgtgaatgac
gcgccttcactcaaggcagctgatgttggcatcgctctcggcagtggctcggacattgcg
atggaggcggccgacatggtcctgttggattcgttctcgtccattgtgattgcggtgcag
tatggccgtgttgtgtttgataacttgaagaaggtcattgcgtatcttctccccgcaggc
tcgttctccgagttctggcctgtcatcacgaatgtcgcgtttggccttccccagattctg
tcatcgtttctcatgattatcatttgctgcttcacggattgcgtggccgccaccgttctg
tcttacgaaaagcccgaggccgacgtgctgcaccgccggccgcgcaacgtgaagaaggac
cgcctggtgaactggcagctcattttccaagcgtacggcgtcattggcatgacggagact
ctggcgtcgtttgccatgtcgtactggtacctcgagcgcaaaggtatcgcgttcaaagac
ctctggttctcgtttggcaagatcccgccgtacgtgacggaggagtactacaacgccaga
ctgacggaagcatcatccatctactttgtcaacctggtggtgatgcagtggttcaacctg
atggcggtacggtgccgccggctcagcattttccagcacccgccagcgttcaacaaggcg
acgcagaacttgtacctttttcccgcgatcctgtttgcgctgagcatggcgttcctttgg
tgctacccaccagcgatccagcgcgtcattgtcacggcgccggtgccggtggagtattgg
ttcctgccgtttgcgtttggcatttatattgtcttcattgacgaagtgagacgattcttt
gtgcgcaagtacccgagcagccttattgcgaaggctgcctggtag

DBGET integrated database retrieval system