KEGG   Cordyceps militaris: CCM_02751
Entry
CCM_02751         CDS       T03108                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
cmt  Cordyceps militaris
Pathway
cmt00100  Steroid biosynthesis
cmt01100  Metabolic pathways
cmt01110  Biosynthesis of secondary metabolites
Module
cmt_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:cmt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    CCM_02751
Enzymes [BR:cmt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     CCM_02751
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 18164778
NCBI-ProteinID: XP_006667966
UniProt: G3JBH3
Position
Unknown
AA seq 488 aa
MAPKAKAAAAPAAHGYEFGGPLGAAGISFGLPILCYIFTFACNDISGCPAPSLLSPKTLS
IEQLQREIGWPKNGIYGLASWQASAAMAAYYLLNLVLYRVLPAIESKGTVLATGGRLNYR
MNTLYSNTLTLSLLAAGTLAQGAQFPVWVFISENYLQLLTASIIISYAIATFVYVRSFSV
KMGNKDNRELAAGGHSGNLLYDWFIGRELNPRVTIPIIGEVDLKEWCELRPGMMGWIILN
CAWCAQQYRNYGYVTDSIICITVVQALYIFDSWWFEPAILTTMDITTDGFGMMLAFGDLV
WVPFVYSQQTRYLSLHPLSLGPVGLVAMLSLIGLGFFIFRSANSQKNAFRTNPSDPSVAH
LKYIQTKTGSRLLTSGWWGVARHINYLGDWIQSWPYCLPTGLAGYQIMAAGSLAEDSVGA
FIMSDGRQVIQGSAKGWAIPITYFYVVYFAVLLIHRDRRDDEKCHRKYGDDWEKYKEAVR
WRIIPGIY
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggctcccaaggcaaaggctgctgctgccccagcggcgcacggctacgaattcggcggc
ccgctcggcgccgcgggtatctcgtttggtctccccatcctctgctacatctttaccttt
gcgtgcaacgacatctcgggttgccccgcaccctcacttctgagccccaagacgctctcc
atcgagcagctccagcgcgagataggctggcccaagaatggcatctacgggctcgccagt
tggcaagccagcgcggccatggcggcatactacctcttgaacctggttctctaccgtgtc
ctgcccgcgattgagtccaagggcaccgtgctcgccactggcggtcgcctcaactaccgc
atgaacactctatactcaaacacgcttacgctgtcgcttctcgccgccggaaccctcgcg
cagggtgctcagttccctgtctgggtctttatcagcgaaaactacctgcagcttctcacg
gcgagcataatcatctcatacgccatcgcgacatttgtctatgtccgcagctttagcgtc
aagatgggcaacaaagacaaccgtgagcttgctgccggcggccactccgggaaccttcta
tatgactggttcattggccgcgaactcaatccccgtgtcaccattcctatcattggcgag
gtggacctgaaggagtggtgcgaacttcgtcctggcatgatgggttggatcatcctcaac
tgcgcttggtgcgcccagcagtaccgcaactatggttacgtcactgacagcatcatatgc
atcaccgtcgttcaagctctgtacatttttgactcgtggtggtttgagcctgccattctc
accaccatggacatcactactgacggctttggaatgatgcttgcctttggtgatctggtc
tgggttccctttgtgtactcgcagcaaacccgctacctgtctcttcacccgttatcgctc
ggacctgtcggactggttgccatgctctccttgattggactcggctttttcatcttccgc
tccgccaacagccagaagaatgctttccgcaccaacccaagcgacccgagcgttgctcat
ctcaagtacattcaaaccaagactggaagcagacttctcaccagtggctggtggggtgtc
gctcgccacatcaactatctgggagactggatccagtcatggccctattgccttccgact
ggactagctggctaccagattatggccgccggcagcctggccgaagattctgtcggcgct
ttcatcatgtccgacggtcgtcaggtcatccagggtagtgccaagggttgggccattccc
attacctacttttacgtggtctactttgccgtgctcctaatccaccgcgatcgccgagac
gacgaaaagtgtcatcgcaagtacggtgatgactgggaaaagtacaaggaggctgtccgc
tggagaatcattcccggcatttactaa

DBGET integrated database retrieval system