KEGG   Cordyceps militaris: CCM_02980Help
Entry
CCM_02980         CDS       T03108                                 

Definition
(RefSeq) cytosolic phospholipase A2 zeta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
cmt  Cordyceps militaris
Pathway
cmt00564  Glycerophospholipid metabolism
cmt00565  Ether lipid metabolism
cmt00590  Arachidonic acid metabolism
cmt00591  Linoleic acid metabolism
cmt00592  alpha-Linolenic acid metabolism
cmt01100  Metabolic pathways
cmt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CCM_02980
   00565 Ether lipid metabolism
    CCM_02980
   00590 Arachidonic acid metabolism
    CCM_02980
   00591 Linoleic acid metabolism
    CCM_02980
   00592 alpha-Linolenic acid metabolism
    CCM_02980
Enzymes [BR:cmt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     CCM_02980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B
Motif
Other DBs
NCBI-GeneID: 18165007
NCBI-ProteinID: XP_006668195
UniProt: G3J870
Position
Unknown
AA seq 783 aa AA seqDB search
MKHPGAILGHLAANGLRPTAVGRAGFSPLQPRLSNGLFTAAKKRPRVSATTPVVAGAFLT
WLFYPTDDFRRLSGQQGQANLVHTSAGTKTDNNAAAEEADETSESDKVGEPAQETAWSHF
TKGLEERSAAADKEWAAFSEKLVGFILPEWSRQIPGYIRKLQHELSDAPGSLAEDLWAEA
HDASVNPEIQYTATVRVSEDLCPDEKEFLERRKKKTRAALAKYLDIDEKDIHPDDIPTIA
MCGSGGGLRALVAGTGSLLAATEDGLFDCATYTAGVSGSCWLQLLYLTSFNKGSIPSLLE
HLKARTCTHIAYPPVALQAFTSLPTSRPLLSGVIEKIRGDKNANFGLVDIYGLLLGARFL
VPKGELGVNDRDFKISNQREILKDGDRPLPIYTAVRHEIPGLEEGKDKTKSSKSPATTKK
ELDKAEEEAWFQWFEITPYEVFCEEIGAGIPTWALGRRFKDGKDVPLEHGFHLPEIRAPL
MMGIFGSAFCATLSHYYKEVQPIVKTLTGFGTIDQMISEQDVALAKVHPIDPATIPNYAY
QMYGKLAKTATPSMYENEHIQLMDAGMSNNLPIYPLLRPGRDVDILVSFDASADIKTDNW
LAVADGYARQRGIKGWPIGVGWPQDEKKAVAEIKAAEAHSTAQADAKIEQAKEEQKQQDQ
RKKSSELGYCTVWIGTTEERTTEEGHPATQPISEAEHWRLTDPNAGLAVVYMPFLPNKKV
PGVSPAESEFMSTWNFIYTPENIDDVVRLARANYDEGKAQIRNTVRAVYERKKQLRLKKE
ESV
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacccgggtgccatcctcggccacttggccgccaacggcctccgtccaaccgcc
gttggccgggccggcttctcccctctgcagccaagactctccaacggcctgttcacggcc
gccaagaagcgaccccgcgtgtctgccaccacgcccgtggtcgcgggggcctttctcacc
tggctgttctaccccacggacgactttcgccgtctgtccggccagcagggacaagccaac
ctggtccacacctctgccggcaccaagaccgacaacaacgcagcagcggaagaggcagac
gagacgtcggagagcgacaaggtcggtgagccagctcaagagactgcttggagccacttc
acaaagggtcttgaggagcgctctgccgctgcggacaaggaatgggcagccttttctgaa
aaacttgttggtttcatcttgcccgagtggtcgagacagatcccgggctacattcgcaag
ctgcaacacgaactctctgatgcccccgggtctctcgccgaggacttgtgggcagaggct
catgatgcctcggtcaacccagaaattcagtatacggctacggtccgcgtttcggaggac
ttgtgcccagacgaaaaggagttcctagagcgccgaaagaagaagacgagagctgctctc
gccaagtatctggatatcgacgaaaaggacattcatccagatgacattcccaccattgcc
atgtgcggctccggtggcggtctgcgcgctctggtggctggaaccggctctcttcttgct
gccaccgaggatggcttgttcgattgtgctacttacactgctggtgtcagtggctcctgc
tggctgcagcttctctatctcacttctttcaataagggcagtatcccttcgcttctagag
cacctcaaagcccgcacttgtactcatattgcctatcctcctgttgccttgcaagcattt
acttcccttccaacttcacgacctctgctgagcggcgtcattgaaaagattcgcggcgat
aagaacgctaattttggtctcgttgatatctacggcctgcttcttggtgcccgatttctt
gtcccaaaaggtgaactgggtgtcaacgaccgcgacttcaagatttccaaccaaagagaa
attctcaaggacggggatcgcccgcttcccatctacactgctgttcgacacgaaatccct
ggtctggaagaaggcaaggataagaccaagtcctccaagagccccgccaccaccaaaaag
gagctcgacaaggctgaggaagaagcctggttccagtggttcgaaattaccccttatgag
gtcttttgcgaagagattggcgccggtattcctacatgggccctcgggcgacgattcaag
gatggcaaggatgtgccgctcgagcacggctttcaccttcccgagatccgcgcacctctg
atgatgggcatcttcggaagcgccttttgcgccactctgagccactactacaaagaagtt
cagcccatagtcaaaaccctgaccggattcggcaccattgatcagatgatttcagagcag
gacgttgccctcgccaaggtacatcccattgaccctgcaactatcccaaactacgcctat
caaatgtacggcaagctcgccaagacggccacgcctagcatgtacgaaaatgagcacatt
cagctcatggacgctggcatgtccaacaacctgcccatctatcccctactccgccctggc
cgcgacgttgacattctcgtctcgtttgacgcctcggccgacatcaagacggacaactgg
ctggctgttgccgacggctacgcgcgccaaagaggcatcaagggctggcctatcggtgtg
ggctggccccaagacgagaagaaggccgttgccgagatcaaggctgccgaagcgcactcc
acagcccaggccgacgccaagattgagcaggccaaagaggagcagaagcagcaggaccag
cgcaagaagagtagcgaactcggctactgcaccgtctggatcggcaccaccgaggaacgc
acgaccgaagaaggccaccccgccacccagcccatctccgaagcggagcactggcgcctg
acggaccccaacgccggccttgccgtcgtctacatgccctttttgcccaataagaaggtg
cccggcgtctccccggccgagagcgagtttatgagcacctggaacttcatctacacgccc
gaaaacattgacgatgtggtgcgtcttgcgcgcgccaactacgacgagggcaaggcgcag
attcggaacacggtacgagctgtgtacgagcgcaagaagcaactgcggttgaaaaaggag
gagtctgtctaa

DBGET integrated database retrieval system