KEGG   Cordyceps militaris: CCM_04648Help
Entry
CCM_04648         CDS       T03108                                 

Definition
(RefSeq) NAD(P)-binding domain
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
cmt  Cordyceps militaris
Pathway
cmt00860  Porphyrin and chlorophyll metabolism
cmt01100  Metabolic pathways
cmt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CCM_04648
Enzymes [BR:cmt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     CCM_04648
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     CCM_04648
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_C Sirohm_synth_M Pyr_redox_3 LSDAT_prok TrkA_N Cytotoxic
Motif
Other DBs
NCBI-GeneID: 18166670
NCBI-ProteinID: XP_006669858
UniProt: G3JGK6
Position
Unknown
AA seq 257 aa AA seqDB search
MPKSFPEPQPGGSLILAWQVKDKNVLVVGGGEVAAGRILNCLNADANVTVVCPAAGLNKE
VAHRVAEKQITHIDRVFEPSDLDNAVMVLVAIDDPDASTVIWKLCKEKKIPANIADVPPE
CDFYFGSVHRDGPLQIMVSTNGRGPRLAASIRRFIASKLPNNAGTAIDVIGELRIKLRKV
APKVEDGPKRMRWMSKVSDTYKWEEMCQMTHEDMENLLLFYPANKAPSMDIVKSLRDVRD
VEALDVFEGSFGFSIGV
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaatcgtttccagagccgcaaccaggaggcagcctcattctcgcgtggcaggtc
aaggacaagaacgttttagtagtcggcggcggcgaggtcgctgcaggtcgcattctcaac
tgcctaaatgccgacgccaacgtgactgtcgtgtgccctgccgccggcctcaacaaagaa
gtcgcccatcgagttgcagagaaacaaatcacacacatcgaccgagtctttgaaccctcc
gatctcgacaatgcagtcatggtcctggtcgccattgacgacccagatgcctccaccgtc
atctggaagctgtgcaaggagaagaagattcctgccaatatcgcagatgtcccgccggaa
tgcgacttttactttggaagcgtccacagagacggccccctacaaatcatggtcagcacc
aatggtcgtggacctcggcttgctgcctccatccgccgctttattgccagcaagctcccc
aacaacgcaggtactgccatcgatgtcattggtgaactgcgaatcaagctgcgcaaagtt
gcccccaaagtggaagatggcccaaagaggatgcgctggatgtccaaagtgagcgacaca
tacaagtgggaagaaatgtgccagatgacacacgaagatatggaaaacttgcttttgttt
tatcccgccaacaaagctccgtccatggacatcgtcaagtcgctccgcgatgtgcgcgac
gttgaggcgctcgacgtcttcgaagggtcgtttggatttagcattggcgtctga

DBGET integrated database retrieval system