KEGG   Cordyceps militaris: CCM_05869Help
Entry
CCM_05869         CDS       T03108                                 

Definition
(RefSeq) pyruvate decarboxylase, putative
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
cmt  Cordyceps militaris
Pathway
cmt00010  Glycolysis / Gluconeogenesis
cmt01100  Metabolic pathways
cmt01110  Biosynthesis of secondary metabolites
cmt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cmt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CCM_05869
Enzymes [BR:cmt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     CCM_05869
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M
Motif
Other DBs
NCBI-GeneID: 18167887
NCBI-ProteinID: XP_006671076
UniProt: G3JHF5
Position
Unknown
AA seq 583 aa AA seqDB search
MTGTMKLATYLFKRLQQLGVDSIHGVPGDFNLTLLDYVEPAGLRWVGSANELNAGYAADG
YSRIKGIGAIVTTFGVGELSAINAIAGAFSERAPVVHIVGVPSRPMQDDRVLLHHSMKDG
DFTRFAQAHALFTVAQARLWDPRTSAEQIDEVLRQCLHHSRPVYIEVPVDMVSAQVSEER
LSQPLQLIQLEPTRNQDRLINRVLDKIHSAKQPVILLDGESRGIGIVQDVQEFSKATGWP
TYVTGFAKGLLDETEPNFHGIYKAKFGEAAAETFLKEADLILCFGPHFSTTNTYGNAALP
NTATTISFSHNETVFQGELIRDTPAKYLVPKILQRVEIAKTKSVYTTYPDLPRDSLLAFS
EVSADAPLAHDRLWNVVGNFLRPGDILMGETGTSSYGSRLVALPKHARYFTHVTWLSIGY
MLPAAQGAAMATEELIKASKFHQDVKESRTFLFIGDGSFQMTTQELATIIRHNLNVIVVL
VNNDGYTVERCIHGKDETYNSVPAWNYLKAPAFFGASDAYTATARTYGELEKVFSDEKLT
DGQGLRMVEIFLGRDDAPQGPLFDYMEVQKAGNGILVEKEELV
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgacaggaaccatgaagctcgccacatacctgttcaagcgtctccagcagctgggcgtc
gactccatccatggtgtccccggcgacttcaacctcactctgctcgactacgtcgagccc
gccggcctgcgatgggtaggaagtgccaatgagctcaatgcgggatacgcggcagacggc
tattctagaatcaagggcatcggcgccattgtcacgacatttggtgtcggcgaactgtca
gccatcaatgccattgcgggggccttttcagagagagcgcctgtggttcacattgttggc
gttcccagccggcccatgcaagatgaccgcgtcctcctccaccacagcatgaaggatggc
gatttcacccggtttgcacaggcacacgccctttttacagttgctcaggctcgtctctgg
gaccctcgaaccagcgctgagcagatcgatgaggtcctgagacagtgtcttcaccacagc
cgtcccgtctatatcgaggtgcctgtcgatatggtatcggcgcaggtctcggaagagcga
ttgtctcagcctctgcagctgattcagctcgaacctaccaggaaccaggaccgcctcatc
aacagggtactggacaagattcactcggccaagcagccagtcattctgctggacggcgag
agcagaggaatcggcattgtccaagatgtgcaggaattctccaaggcgaccggctggccg
acgtatgttactggatttgccaagggactgttggacgagacggagccgaatttccatggc
atctacaaggcaaagtttggtgaggcggctgctgagacatttctcaaagaggctgacttg
attctttgcttcggcccccatttcagcacgacgaacacgtacggtaatgctgccctaccc
aacaccgccactaccatttcctttagccacaacgagactgtctttcaaggcgagctgatt
cgcgatacgcccgccaaataccttgtccccaagattctccagcgcgtggaaatagccaaa
accaaaagcgtctacaccacataccccgatcttcccagagactcccttctggccttttct
gaggtctccgcggatgcgccgctagctcatgaccgtctctggaacgttgttggcaatttt
cttcgtccaggtgatattctcatgggcgaaaccggtacatctagctatggctcgcgcctt
gtggcgctaccaaagcacgcccgctactttactcacgtaacatggctttccatcggttac
atgcttccagccgcacaaggcgctgccatggctaccgaggaactcatcaaggcatccaag
tttcatcaggatgtcaaagagtcgcgaacctttttgttcattggagacggcagtttccaa
atgacaacacaagagcttgccacaatcattagacataacctcaatgtgattgttgtgctc
gtcaacaacgacggctataccgtggagcgttgcattcatggcaaggatgagacatacaat
agcgtgcccgcctggaactacctcaaggcaccagcatttttcggcgccagcgacgcttac
acggccaccgcgcgaacatacggagaacttgaaaaggtattcagcgacgagaagctcacg
gatggccagggtctgcgcatggttgagattttcctcggccgtgatgacgcaccgcagggt
cctctttttgactacatggaagttcaaaaggctggcaatggcatcctagttgaaaaggaa
gagcttgtgtag

DBGET integrated database retrieval system