KEGG   Cordyceps militaris: CCM_07577Help
Entry
CCM_07577         CDS       T03108                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase
  KO
K09568  FK506-binding protein 1 [EC:5.2.1.8]
Organism
cmt  Cordyceps militaris
Brite
KEGG Orthology (KO) [BR:cmt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cmt03110]
    CCM_07577
Enzymes [BR:cmt01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     CCM_07577
Chaperones and folding catalysts [BR:cmt03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    CCM_07577
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 18169588
NCBI-ProteinID: XP_006672781
UniProt: G3JQ75
Position
Unknown
AA seq 113 aa AA seqDB search
MGVSKTTIKSGSGVQPKPGQTVVIEYTGWLKDTSKPDNKGNKFDSSVGRGDFEVKIGVGQ
VIRGWDEGVPQMQVGEKATLDISSDFGYGARGFPGHIPAGADLIFDVELKNVK
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgggtgttagcaagaccactatcaagagcggctccggcgtccagcccaagcctggacag
accgttgtcatcgagtacacgggctggttgaaggacaccagcaagcccgacaacaagggt
aacaagtttgactcctctgtcggccgcggtgactttgaggtcaagattggtgttggccag
gttattcgaggctgggacgagggtgttcctcaaatgcaggttggcgagaaggccaccctg
gacattagcagcgattttggatacggtgctcgcggtttcccaggtcacatccccgccggg
gccgacctgattttcgatgttgagctcaagaacgtcaaatag

DBGET integrated database retrieval system