KEGG   Cordyceps militaris: CCM_09213Help
Entry
CCM_09213         CDS       T03108                                 

Definition
(RefSeq) phosphatidylserine decarboxylase family protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
cmt  Cordyceps militaris
Pathway
cmt00564  Glycerophospholipid metabolism
cmt01100  Metabolic pathways
cmt01110  Biosynthesis of secondary metabolites
Module
cmt_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:cmt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CCM_09213
Enzymes [BR:cmt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     CCM_09213
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PSDC PS_Dcarbxylase Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 18171216
NCBI-ProteinID: XP_006674410
UniProt: G3JTS3
Position
Unknown
AA seq 583 aa AA seqDB search
MSTKLYGLNYPGNPPMSCRHQPAPTRRMLARRTREEEYARQDRTELSRESTVHNACFNTS
CKRNPRNVGAAGIPGFAVAAGRIGHVRHTGITIAKLGISRRVARQQSLKFWSLYKDNGSY
IKYHEVKEDFEFRKPQTASESNFPMHRLTTKLRPGAWLPADHRIHRQYLAEVIDSVDSGK
TAGGALSPALQEFRDLIEGNARIYMYFVQMFDEVPRKQPYLRDPAGHKQVRDYEHMLRVL
NHIVTRAPAWTQTEAAMGVVGVPMCAVFDYPMGTPSGHAAFLDPDVNKALKKVLNEWGKY
LQTPESAAVLGDHATGWFGETGRHDLLQVANAPYKSSHKFEDMFVCDPSAKHMGFKSWDD
FFTRKVHDTARPVASPDDDSVIANACESKIFNVQANAQLRDHFFAKGQRYSLLDMLGHDV
LASRFVGGTVYQAFLSALSYHRWHSPVSGVVRRALLVDGTYFSEPLFEGPGDASVEQIDT
GGISVAQGYLACMAARAVIVLQADNADLGLVAFVGIGMDEVSTCDITVKEGQRVKKGEEL
GMFHFGGSTHCLVFQKGVRLEGLPEVGRVENVPVRGKLATVKR
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgtccactaaactctatggtctcaactatccaggtaacccaccaatgagctgtcgacac
caaccagcccccacgcgtaggatgctggcacgcaggacgcgcgaggaagaatatgcgcgg
caagaccgtacggagctgtcaagagaaagtacagtacacaacgcctgttttaatacaagc
tgcaaacgcaaccctcgcaacgttggcgcggccggtatacccggtttcgcggttgcggcg
ggccggatcggtcatgtacgtcatacaggcatcaccatcgccaagctcggcatctcgcgc
cgggtagctcggcagcagagcctcaaattttggtctttatataaagacaatggaagctac
attaagtaccacgaggtgaaggaggattttgaatttcgcaaaccacaaacagccagtgaa
tccaatttcccaatgcatcggctgaccaccaaattaagacccggtgcatggctgcccgcc
gaccaccgcatccaccggcagtacctcgccgaggtgattgactcggtcgactccggcaag
acggccggcggcgcgctgtcgccggcgctgcaagagttccgcgacctgattgagggcaac
gcgcgcatctacatgtactttgtgcagatgtttgacgaggtgccgcgcaagcagccgtac
ctgcgcgacccggcgggccacaagcaggtgcgcgactacgagcatatgctgcgcgtgctc
aaccacattgtgacgcgggcgccggcgtggacgcagacggaggcggccatgggcgtcgtc
ggcgtgccaatgtgtgcggtttttgactacccgatgggtaccccgagtgggcatgccgct
tttttggatccagatgtgaacaaggcgctgaaaaaggtcctgaatgaatggggcaagtat
ttgcagacgccggagtcggcggctgtgctaggcgatcacgccacgggctggttcggcgag
acgggccgccatgacttgctgcaggtcgccaatgcgccgtacaagtcgagccataaattt
gaggacatgtttgtgtgcgatccgtcggcgaagcacatgggcttcaagtcttgggatgac
ttcttcacgcgcaaagtgcacgacacggcccggcccgttgccagccccgacgacgactcc
gtcatcgccaacgcgtgcgagtccaaaatcttcaacgtgcaggccaacgcgcagctccgc
gaccacttcttcgccaagggccagcggtactcgctgctggacatgctggggcacgacgtg
ctcgcgtcgcgcttcgtcggcggcaccgtgtaccaggcgttcctctcggcgctgtcgtac
caccgctggcacagccccgtgtcgggcgtggtgcggcgggcgctgctcgtcgacgggacc
tactttagcgagccgctcttcgagggccccggcgacgcgagcgtcgagcagatcgacacg
ggcggcatcagcgtcgcgcaggggtacctggcgtgcatggcggcgcgcgccgtcatcgtg
ctgcaggcggacaacgcggacctcgggctggtggcgtttgtgggcatcggcatggacgag
gtgagcacgtgcgacatcacggtcaaggagggacagcgggtgaagaagggcgaggagctc
ggcatgtttcactttggaggcagcacgcactgcttggtgttccagaagggcgtccgcttg
gagggcctgcccgaggtcggcagggtcgagaatgtgccggtgcgaggaaagctggcgacg
gtaaagaggtag

DBGET integrated database retrieval system