KEGG   Chlamydia muridarum Nigg: TC_0139Help
Entry
TC_0139           CDS       T00028                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
cmu  Chlamydia muridarum Nigg
Pathway
cmu00471  D-Glutamine and D-glutamate metabolism
cmu00550  Peptidoglycan biosynthesis
cmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    TC_0139 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TC_0139 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cmu01011]
    TC_0139 (murD)
Enzymes [BR:cmu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     TC_0139 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:cmu01011]
 Precursor biosynthesis
  Amino acid ligase
   TC_0139 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C 2-Hacid_dh_C Pyr_redox_2 3HCDH_N DAO Mur_ligase TrkA_N UDPG_MGDP_dh_N FAD_binding_3 Oxidored_q6 AlaDh_PNT_C DUF1188 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AAF39017
UniProt: Q9PLG5
Position
170341..171642
Genome map
AA seq 433 aa AA seqDB search
MCCHWYFRCILGLEDKRMGLKRVVVIGLGLSGKSIARFLARKGVYVLGVDSSIQALQHCP
YIHEKLLETDEFPTQVDYVVRSPGISKDHPWVKAARAAQISVVTDIQLAFQTKEFIEQKS
FGITGTVGKTTTILFLEYLLRKAGIPAFAMGNVGVPILDGMQNSGVRLVEMSSFQLADQE
TSYPVLSGGMILNISDNHLDYHGSFLEYCQSKQNLSLCMRNPEDLWVGDQRFCGRSYWEE
VQKYMRLLDKESALKPLYLHDKYNYCCAYLLAQAEFPIAKSLFIEAVATFKKPSHRMEYL
GEKCGVHYINDSKATTVRATEKALLSIGSRAIVILGGRNKGYSFVSLLPSLRRFAKSVVA
MGECAQEIAQDLDGFPVTVVRNLHEALLCAEEQAIPGDVVLLSPACASFDQFRSYEERGA
IFKQLVGMEEVLL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
ttgtgttgccattggtattttcgctgtattttggggttagaggataagcgaatgggatta
aaacgtgttgtagttattggcttaggactatctggtaagtctattgcgcgtttcttagct
cgaaaaggcgtgtatgtgttgggagtagatagttctattcaggcgttgcaacattgtccg
tatattcatgaaaaattgttagaaacagatgagtttcctacacaggtagattatgttgta
cgttctccggggatttctaaggatcatccttgggtcaaggctgcaagagctgctcaaatc
tctgtagtgacagatattcaactagcttttcagactaaggagtttatagaacagaagtct
tttggaattacagggactgtagggaaaacgaccacaatattatttttagaatatttgcta
agaaaagcgggaatcccagcttttgccatggggaatgtgggagtccctattttggatggt
atgcagaattcgggagtccggcttgttgaaatgagttctttccagctcgctgatcaagaa
acctcttatccggtcttatcagggggaatgattcttaatatctcggataatcatttggat
tatcacgggagttttttagagtattgtcaatccaaacagaatctctctttatgtatgagg
aatccagaagatctttgggttggggatcagcgtttttgcgggcgtagttactgggaagaa
gtgcaaaagtacatgcgtttactagataaagaaagtgcattaaaaccattgtacttgcat
gataagtacaactactgttgtgcatatctgcttgctcaagcagaatttccgatagctaaa
tccctttttatagaggccgtagctacttttaagaaaccttcgcataggatggaatattta
ggggaaaagtgtggtgtgcattatatcaatgatagtaaggcaactacagtacgcgctacg
gaaaaggctcttttgagcataggaagtcgggcaattgtgattcttgggggtagaaataaa
ggatactcgttcgtttccttgctgccttctttgcgaaggtttgcgaagagtgtggttgct
atgggagagtgtgctcaggagatagctcaggatttggacggcttcccagtaacagtagtg
agaaatttacatgaagctttgctatgcgctgaagagcaagcgattcccggagatgttgtt
ttattgtctccagcttgcgctagctttgatcaatttcgtagctatgaagagcggggagcg
atatttaagcagttggttgggatggaagaggttcttttatga

DBGET integrated database retrieval system