KEGG   Chlamydia muridarum Nigg: TC_0810Help
Entry
TC_0810           CDS       T00028                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
cmu  Chlamydia muridarum Nigg
Pathway
cmu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    TC_0810 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cmu03011]
    TC_0810 (rplV)
Ribosome [BR:cmu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    TC_0810 (rplV)
  Bacteria
    TC_0810 (rplV)
  Archaea
    TC_0810 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AAF39613
UniProt: Q9PJL9
Position
complement(945468..945803)
Genome map
AA seq 111 aa AA seqDB search
MFKATARYIRVQPRKARLAAGLMRNRSVVEAQQQLSFSQMKAGRCLKKVLDSAVANAESN
ENVKRENLCVVEVRVDAGPMFKRVKSKSRGGRAPVLKRTSHLTVIVGERGQ
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaagcgacagcccgatacatacgggttcagccaagaaaagctcgtttggctgca
gggttaatgagaaatcgtagcgttgttgaagctcaacaacagcttagcttttctcaaatg
aaggctggaagatgtcttaaaaaagttttggatagcgcggttgcgaatgcggaatccaat
gagaatgtaaaacgagagaacctttgcgttgttgaagttcgggttgatgccggcccaatg
ttcaaaagagtaaaatctaaaagtcgtgggggacgagcccctgttttgaaacgcacgagt
catctaactgtgattgttggcgaaagagggcagtag

DBGET integrated database retrieval system