KEGG   Chlamydia muridarum Nigg CM972: Y015_00555Help
Entry
Y015_00555        CDS       T03671                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone 4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
cmur  Chlamydia muridarum Nigg CM972
Pathway
cmur00740  Riboflavin metabolism
cmur00790  Folate biosynthesis
cmur01100  Metabolic pathways
cmur01110  Biosynthesis of secondary metabolites
Module
cmur_M00840  Tetrahydrofolate biosynthesis, mediated by ribA and trpF, GTP => THF
Brite
KEGG Orthology (KO) [BR:cmur00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Y015_00555
   00790 Folate biosynthesis
    Y015_00555
Enzymes [BR:cmur01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     Y015_00555
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     Y015_00555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2 DUF5615
Motif
Other DBs
NCBI-ProteinID: AHH23427
Position
123067..124341
Genome map
AA seq 424 aa AA seqDB search
MVTCEAGIASVQQAIKDIADGNFVIVIDRESRENEGDLILAGEKVSAEKMAFLLSHTTGI
VCASVTREQARVLDLPAMVQENQCAFKTAFTVSVDASSGITTGVSAADRTRTVQLLSDPT
SISQSFVRPGHVFPLVSQPGGVVKRPGHTEASMDLMRLAGMYPCGIFAELVNADHSMMRQ
QQILDFAEQHGFTVITVDDLITYRWTFDSLVEHVSSARIPTKYGEFFIHVYKSIIDGTEH
FALVKGDIREQESVPVRVHSECLTGDVLGSCRCDCGAQLDMAMRYIAEQGLGVIVYLRGQ
EGRGIGFGHKIQAYALQDLGYDTVEANLQLSFPIDAREYGVAAQILKDLRLTSVRLITHN
PKKFFELQRLGIHILDRIVLPVIVSSENERYLRTKKDRMGHWLNFPVLNESEDEYETVER
TSCC
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggttacatgtgaagccgggatagcttcggtacagcaagcgataaaagatatcgctgac
gggaattttgtcatagttattgatagggaatctcgagagaacgagggagacttaatttta
gcaggagaaaaggtctcggcagaaaaaatggcctttcttttgtctcacacaacgggcatt
gtctgcgcttcggtcactcgtgagcaagcaagagttttggacctgcccgcaatggttcaa
gagaaccaatgtgcctttaaaacagcttttactgtttctgtagatgcttcgtcaggaatt
actacgggagtttctgcagcggatagaacgagaacagttcaattattatccgacccaacg
tcaatttctcaatcttttgttcgtccaggacatgttttccctttagttagtcagcctggt
ggagtagtcaaacgtccaggacatactgaagcatccatggatctcatgcggcttgctggg
atgtatccttgtggtatttttgctgagcttgtcaatgcagatcattctatgatgcggcaa
caacagatactagattttgctgagcaacatggttttacggttattaccgtagatgatctg
attacttatcgatggacctttgattctttagttgagcatgtttcttcagcacggattcct
accaaatatggggagttcttcatacatgtttataaatcgattattgatggaacagagcat
tttgctttagtgaagggagatattcgggaacaagaatccgtgcctgtgcgtgtgcactca
gaatgcttaaccggagatgttttggggtcttgtcgttgtgattgcggagctcagttggat
atggctatgcggtatattgcagaacagggcttaggcgttattgtgtatcttcgagggcaa
gaagggcgcggtataggttttgggcataaaattcaagcttatgctttacaagatcttgga
tatgatacggtagaggccaatctccaactaagttttcctatagatgctcgagagtatgga
gtagctgcacaaattcttaaggatctccggttgacaagcgtgagattgatcacccataat
ccaaaaaagttttttgagctacagcggttaggaatacacattctcgaccggattgttttg
cccgtcatcgtctcttctgaaaatgagaggtatttacgaacaaaaaaagaccgaatgggg
cattggttgaatttccctgttcttaatgagtcggaggatgagtatgaaactgttgaaagg
acttcctgttgctaa

DBGET integrated database retrieval system