KEGG   Chlamydia muridarum Nigg CM972: Y015_04290Help
Entry
Y015_04290        CDS       T03671                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
cmur  Chlamydia muridarum Nigg CM972
Pathway
cmur03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cmur00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Y015_04290
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cmur03011]
    Y015_04290
Ribosome [BR:cmur03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Y015_04290
  Bacteria
    Y015_04290
  Archaea
    Y015_04290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AHH24122
Position
complement(945470..945805)
Genome map
AA seq 111 aa AA seqDB search
MFKATARYIRVQPRKARLAAGLMRNRSVVEAQQQLSFSQMKAGRCLKKVLDSAVANAESN
ENVKRENLCVVEVRVDAGPMFKRVKSKSRGGRAPVLKRTSHLTVIVGERGQ
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaagcgacagcccgatacatacgggttcagccaagaaaagctcgtttggctgca
gggttaatgagaaatcgtagcgttgttgaagctcaacaacagcttagcttttctcaaatg
aaggctggaagatgtcttaaaaaagttttggatagcgcggttgcgaatgcggaatccaat
gagaatgtaaaacgagagaacctttgcgttgttgaagttcgggttgatgccggcccaatg
ttcaaaagagtaaaatctaaaagtcgtgggggacgagcccctgttttgaaacgcacgagt
catctaactgtgattgttggcgaaagagggcagtag

DBGET integrated database retrieval system