KEGG   Corynebacterium mustelae: CMUST_01535Help
Entry
CMUST_01535       CDS       T03941                                 

Definition
(GenBank) acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
cmv  Corynebacterium mustelae
Pathway
cmv00061  Fatty acid biosynthesis
cmv00071  Fatty acid degradation
cmv01100  Metabolic pathways
cmv01212  Fatty acid metabolism
cmv02024  Quorum sensing
Module
cmv_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:cmv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CMUST_01535
   00071 Fatty acid degradation
    CMUST_01535
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CMUST_01535
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cmv01004]
    CMUST_01535
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmv04147]
    CMUST_01535
Enzymes [BR:cmv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     CMUST_01535
Lipid biosynthesis proteins [BR:cmv01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   CMUST_01535
Exosome [BR:cmv04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   CMUST_01535
  Exosomal proteins of breast cancer cells
   CMUST_01535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AKK04656
UniProt: A0A0G3GU44
Position
complement(314423..316126)
Genome map
AA seq 567 aa AA seqDB search
MSAFETKAWLSYYGEWTPHNLDYEDTTLLDVYDNNLAINADKTATYFFGRSQTYGDLDKQ
VRSAAAGLRALGVRPGDRVAIILPNCPQHVAAYFAVLKLGAIVVEHNPLYTAHELEGPFK
DHAARVAIVWDKAAATLEKLRRTTPLETIVSVNMIDAMPRSKQILLSLPLPMIAKKREAL
TAPAPHSIPWDALIGSALGGTGDDIASEISVSKNSVAVILYTSGTTGAPKGAQLTHGGLF
ANLLQGKAWVRGLGDQDERMLAALPFFHAYGLTIVLNLAVYVGAEMELLPAPQIPLVMQI
MKKRTPTWVPGVPTLYQKIVEAAQKEGISISGIRNSFSGASTLPVQTVEEWEKLTGGLLV
EGYGLTETSPIIVGNPMNSNRRPGYVGIPFPDTEVRIGNPENLDETMPDGSEGEVLVRGP
QVFAGYLNNPEATANSFHKDWYRTGDVGVMEEDGFIRLVARIKEVIITGGFNVYPLEVEE
VLQTHPDVDDCAVVGLPREDGSESVVAAITLMEGAALDPEGLKAFCRERLTRYKVPRTFY
HFEDLPRDQMGKIRRREVQEQLVKKRR
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcttttgaaaccaaagcctggttgagttactacggcgaatggacgccacataac
ttggactatgaagacacaacgcttcttgatgtctatgacaacaacctggcaatcaacgcc
gataaaaccgccacgtatttctttggccgcagccaaacctatggcgacctagataaacaa
gttcgttccgctgccgccggtctgcgcgcccttggcgttcgccccggcgaccgggtcgcc
atcattttgcctaactgtccacagcacgtggcggcatattttgccgtgttgaaattgggc
gccatcgtggtggaacacaatccgttatacaccgcacacgaattagaaggcccgtttaaa
gatcatgccgcccgggttgccatcgtgtgggataaagctgcggccaccttggaaaagcta
cgccgcaccaccccactggaaaccatcgtgtcagtgaacatgatcgatgcgatgccaagg
tctaagcaaatcctgctcagtttgccgctgccaatgattgccaagaaacgggaagcactc
accgcaccagcaccacactccatcccatgggacgcactcattggtagtgcattgggcggc
accggcgatgacattgcctctgaaatttccgtgtccaagaattcagttgcggttatcctc
tatacttccggcactaccggcgcccccaagggtgcgcagcttacccatggcggattattc
gccaacctattgcagggtaaagcgtgggttcgcggacttggcgatcaagacgaacgcatg
ttggccgcgctgccgtttttccatgcctatggtctaaccatcgtacttaacctcgcggtc
tatgtgggtgccgaaatggaactactaccagcacctcagatcccactggtcatgcagatc
atgaaaaaacgcactcccacctgggttccaggggtgcccaccctgtatcaaaagatcgtg
gaagcagcacaaaaggaagggatctccatttccgggattcgcaattccttctcgggtgcc
tctaccttgcctgtgcaaactgtggaagagtgggagaaactcaccggagggctgctagta
gaaggctacggattgaccgaaacttcccccatcatcgtgggcaaccccatgaattccaac
cggcggcctggctacgtcggtatcccgttcccggatactgaggttcgaatcggaaatcca
gaaaaccttgacgaaaccatgccggatggctccgagggcgaagtattagtgcgaggcccg
caggttttcgcaggttatctcaataacccggaggccaccgctaattccttccacaaagat
tggtaccgcaccggcgatgtgggagtcatggaagaagacggttttatccggctggtggcc
agaatcaaggaagtcatcattaccggtggcttcaatgtctacccgttggaagtagaagaa
gtactgcaaacccaccccgatgttgatgattgcgcggttgtgggtctaccacgggaggac
ggatcagaatcagtcgttgctgccatcacgcttatggaaggtgctgcgcttgatccggaa
ggactcaaagcattctgccgggaacgtctcacccgctataaggtgccacgtaccttctac
cactttgaggatctcccccgcgaccaaatgggtaaaatccgacggcgggaagtccaagaa
cagctggtgaagaagcgtcgctaa

DBGET integrated database retrieval system