KEGG   Corynebacterium mustelae: CMUST_03410Help
Entry
CMUST_03410       CDS       T03941                                 

Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
cmv  Corynebacterium mustelae
Pathway
cmv00020  Citrate cycle (TCA cycle)
cmv00620  Pyruvate metabolism
cmv01100  Metabolic pathways
cmv01120  Microbial metabolism in diverse environments
cmv01200  Carbon metabolism
cmv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cmv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CMUST_03410
   00620 Pyruvate metabolism
    CMUST_03410
Enzymes [BR:cmv01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     CMUST_03410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Dala_Dala_lig_C ATP-grasp ATP-grasp_3 RnfC_N Biotin_lipoyl_2 GCV_H NQRA HlyD_D23 DUF2118
Motif
Other DBs
NCBI-ProteinID: AKK05026
UniProt: A0A0G3GV17
Position
704571..707972
Genome map
AA seq 1133 aa AA seqDB search
MSKTSQLPTFNKVLVANRGEIAVRAFRAAYEIGAKTVAVYPTEDRNSLHRSIANESCRIG
TEGSPVKAYLDIDEILAAAEKTGADAVYPGYGFLSENAQLARECAENGIVFIGPTPEVLE
LTGDKAAAVAAARRAGLPTLDESEASDDIEILLAQAEGQTFPLFVKAVAGGGGRGMRFIP
SIEELPQLAAEASREALSAFGDARVYLERAVINPQHIEVQILGDHTGDVIHLYERDCSVQ
RRHQKVVEIAPAQHIDADLRERICADAVNFCKEIGYTGAGTVEFLVDEAGNHVFIEMNPR
IQVEHTVTEEVTGVDLVKAQMRIAAGATLQELGLSQENIHTEGAALQCRITTEDPANGFR
PDTGFITAYRSPGGAGVRLDGAAQLGGEITAHFDSMLVKLTCRGADFAGAVARAQRALAE
FTISGVATNVGFLRALLREPDFLDTRIATSFISDHPWLLSAPPADDEPGRILDYLADVTV
NRPHGLPPAVGAAVEKLPPLGTLRRGSRDLLRDLGPKKFAEHLKNQRALAITDTTFRDAH
QSLLATRVRSAALVDAARHVAHLTPELLSVEAWGGATYDVAMRFLHEDPWERLDNLRQAM
PNINIQMLLRGRNTVGYTPYPDTVCRAFVDEAARTGIDIFRIFDALNDVSQMRPAIEAVL
ETNTAVAEVAMAYSGNLVDPGEKLYTLDYYLKLAEEIVNSGAHILAIKDMAGLMRPAAAT
KLITALRKEFDLPIHVHTHDTAGGQLATYLAAAHAGADAVDGASAPLSGTTSQPSLSAIV
AAFANTPRDTGIALSAVTDMEPYWEAVRHMYAPFETGTPGPTGRVYRHEIPGGQLSNLRA
QAVALGLADRFELIEEYYAAVNDMLGRPTKVTPSSKVVGDLALYLVGAGVKPEDFAADPQ
KYDIPDSVIAFLNGELGTPPGGWPEPLRAKALEGRSIQPAATEVPESEAEALTSSDAKTR
RGALNRLLFAKPAAEFAEHRRRFGDTSVLTDREFFYGLVEGKETVIDLSDNTHMLVRLDA
LSEPDEKGMRTIVCNVNGQIRPMRVRDRSVESIVATAEKADPNNSGHVAAPFAGVVTVTV
AVGDTVEEGQAVAVIEAMKMEATITSPIAGTVSRVVLSQATKVEGGDLLLVVE
NT seq 3402 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaaacctcacagcttccaaccttcaataaggttcttgtcgctaaccgcggcgaa
atcgcagtgcgagccttccgcgccgcatacgaaattggagctaaaacggtcgcggtgtac
cccaccgaagaccggaattcattgcaccgatccatcgccaatgaatcttgcagaatcggt
acagaaggctcaccagtaaaagcctatcttgatatcgacgaaatcttagccgcagccgaa
aaaaccggtgccgatgcggtttatcccggatatggcttcctctccgagaatgcgcaactc
gcccgcgaatgcgcagaaaacggaattgtgttcatcggccccacaccagaagtactggaa
ctgacaggagacaaagctgcggcggtggcggctgcgcggcgcgccggattgcctaccctt
gatgaatccgaggccagcgatgatattgagattctcctcgcccaggcggaaggccaaact
ttcccgctatttgtaaaagcggtggctggtggcggcggccgtggtatgcggtttatccct
agcattgaggagttgcctcagttggctgcggaagcctcccgggaagcactcagcgcattc
ggcgatgcccgagtctacctagagcgtgcggtgattaatccgcagcacattgaggtacag
atcttaggcgaccacaccggtgacgttattcacttgtatgagcgtgactgttcggtacag
cggcggcaccaaaaggtggtggaaatcgccccagctcaacacattgacgcggatcttagg
gaacgcatctgcgccgatgcagtgaatttctgcaaagaaatcggctacaccggcgccggc
accgtggaattcttggttgatgaggccggaaaccatgtctttatcgagatgaacccccgc
attcaggttgaacacacggttaccgaagaagtaaccggggtggacttggttaaggcacaa
atgcgaatcgctgctggtgctaccttgcaggaactggggctgagccaagaaaatatccac
accgaaggcgcagccctgcaatgccgcatcactactgaggatccggccaatggcttccgg
ccggataccggttttatcaccgcttaccgcagccccggtggcgcgggggttcgtttggat
ggcgccgcccagctgggtggcgaaatcaccgctcacttcgactccatgttggtgaaacta
acctgccgtggtgcggatttcgccggtgccgttgcccgtgctcagcgcgcactcgcggaa
ttcaccatttctggtgtcgctaccaatgttggcttcctgcgggcattgttgcgcgaaccg
gacttcctggatacccgcatcgccacttcgttcatcagcgatcatccgtggctactatct
gccccacctgccgatgacgaaccggggcggatcttggactatctcgccgatgttactgtc
aaccggccacatggattgccacctgcggtaggcgccgccgtcgaaaagctaccgccgctt
ggtacgctgcgacgcggatcgcgggatctgctacgcgaccttggacctaagaaatttgcc
gaacatttaaagaaccaacgcgcgttggccatcaccgacaccacgttccgggacgcccac
cagtcgcttttggcaacccgggtgcgttctgcagccctagtcgatgccgctcgccacgta
gcccacctgaccccggagctgctgtcggttgaagcgtggggtggcgcgacctacgacgtt
gccatgcgctttttgcacgaggatccgtgggaacggctggataatttacgccaggcaatg
ccgaatatcaatatccaaatgctgttacggggtagaaataccgttggctatacgccatat
cctgacaccgtgtgtcgagcatttgtcgacgaagcggcccgcaccggcattgatattttc
cgaattttcgacgcgcttaacgacgtctcccagatgcggcctgctatcgaagcggtgcta
gaaaccaatactgcggtggctgaagtggcgatggcgtattccggcaacctggttgaccca
ggtgaaaagctctataccctcgactactacctgaaactagccgaggagatcgtcaactca
ggggcgcacatcctcgccattaaagacatggctggactcatgcgcccagctgccgcaaca
aaattgattaccgcgttacgcaaggaattcgacctaccgattcacgtgcacacccacgac
actgctggtggacaattagccacctacctcgcggcagcacacgccggagccgacgcagtt
gacggggcttcagcaccgctgtctggtactaccagtcaaccgtcactatccgccatcgtc
gcagctttcgccaacaccccgcgtgatacaggcattgcactgtcggccgtcaccgacatg
gaaccgtactgggaagctgtgcgccacatgtacgccccatttgaaaccggaaccccaggg
ccaaccggccgggtgtatcgccacgaaatccccggcggccagttatcgaacctgcgagct
caggccgtggcgcttgggcttgccgaccgcttcgaactaatcgaggaatactacgccgcc
gtcaacgacatgttgggtcgccccaccaaggtcaccccatcctccaaagttgttggcgac
ctggcgctctacctggttggcgctggcgtgaaaccggaagatttcgccgcagatccccaa
aaatacgacattccggattccgttatcgcgttcctcaatggcgaactgggcacgcctccg
ggtggctggccggagccactgcgggccaaggcattagaagggcgaagcattcaacctgcg
gccaccgaggtgccggaatctgaggcggaagccttaacatcatctgatgcgaagacccgt
cggggcgcactgaatcggttgctgtttgctaagccagcggctgaatttgctgaacaccga
cgtcggtttggcgacacctcggttctcactgaccgggaattcttctatggattggtggaa
ggaaaggaaaccgtcatcgatttaagcgataacactcatatgctggtccggcttgacgcg
ctttccgaaccagatgaaaagggtatgcgcaccatcgtgtgcaatgtcaacggtcagatt
cggccgatgcgggtgcgagaccggtccgtggaatccatcgtggcgacggcggagaaagcc
gacccgaataattccggtcatgttgccgcgccattcgcaggcgtggttaccgttaccgtc
gcggtcggtgacaccgtggaagaaggccaagcagttgctgttattgaggcgatgaagatg
gaagcaacaatcacgtctccgatcgctggcaccgttagccgggtggtgctaagccaagcc
accaaggtcgaaggcggtgacctgctgctcgtggtggaataa

DBGET integrated database retrieval system