KEGG   Corynebacterium mustelae: CMUST_05075Help
Entry
CMUST_05075       CDS       T03941                                 

Gene name
metG
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cmv  Corynebacterium mustelae
Pathway
cmv00450  Selenocompound metabolism
cmv00970  Aminoacyl-tRNA biosynthesis
cmv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CMUST_05075 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CMUST_05075 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cmv01007]
    CMUST_05075 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cmv03016]
    CMUST_05075 (metG)
Enzymes [BR:cmv01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CMUST_05075 (metG)
Amino acid related enzymes [BR:cmv01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CMUST_05075 (metG)
Transfer RNA biogenesis [BR:cmv03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CMUST_05075 (metG)
 Prokaryotic type
   Other AARSs
    CMUST_05075 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AKK05353
UniProt: A0A0G3H0K8
Position
1052314..1054146
Genome map
AA seq 610 aa AA seqDB search
MNNVLVSVAWPYANGPRHIGHVAGFGVPSDVFARYQRMSGANVLMVSGTDEHGTPLLVQA
DKEGISVKELADRYNRQIVEDLAGLGLSYDLFTRTTTRNHYAVVQELFKGLYDNGYMIKE
TTFGAVSPSTGRTLPDRYIEGTCPICGADGARGDQCDNCGNQLDPADLINPVSKINGETP
EFIETEHFLLDLPALADALAQWLQGRKDWRPNVLKFSLNLLEDLRPRAMSRDIDWGIPIP
VEGWEENPSKKLYVWFDAVIGYLSASIEWAFRVGEPDGWKKWWTDPSTRSYYFMGKDNIT
FHSQIWPAELLGYQGKGAKGGQLRAYGELNLPTEVVSSEFLTMSGSKFSSSKGVVIYVKD
FLAEFGPDPLRYFIATAGPENNDTDFTWDEFVRRINNELANGWGNLINRTVSMAYKNFGV
VPTPGELVDADKAILTTAADAFETVGQAIGQSRFKEGITKAMHVVGEANAYIAEQEPWKL
AKDDTQRDRLATVLWTALQVVSDINVLLTPYLPHIAQSVHETLGRTGVWAAQPEIVEVID
DMPTEPVGVGLPEQGATYPVIMGDYANQQAVWRRIEMVPGVELSKPQPLIAKLDPELAET
GPTWAPVEKQ
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgaataatgtgctcgtctctgttgcttggccatacgctaatggcccccgccacatagga
catgtggcgggtttcggtgttccatcggatgttttcgctcgttaccaacgaatgtcaggt
gcgaacgtgctgatggtttccggtacagacgagcacggcacgccgcttttggtgcaggcg
gataaagaaggaatttctgtcaaagaacttgctgatcgctacaaccgccagatcgttgaa
gatttggcagggcttggcttgtcctatgatctattcacccgaaccaccacccgcaatcac
tacgcggtggttcaggaattatttaagggcctgtacgacaacggctacatgattaaggaa
acgacgtttggggcggtttccccatcaacgggtcgcaccttgccggatcgctacatcgaa
ggtacctgtccgatttgtggtgcggatggtgcccgaggagatcagtgcgataattgcgga
aaccagctagacccagcagatttaattaatccggtgtcaaagatcaacggggaaactccc
gaattcatcgaaactgaacatttcctactggatttaccagcgcttgcggatgcgcttgcc
cagtggcttcaagggcgtaaggactggcggcctaatgtgctgaagttctcactcaatctg
ctcgaagatttgcggccgcgcgcgatgtcccgggacatcgactggggcattccgatccca
gtggaaggatgggaagaaaacccatcgaagaagctgtatgtctggtttgacgcggtgatt
ggatatttatccgcctcgatcgaatgggcgtttcgagtaggtgagccggatggatggaag
aagtggtggactgaccctagtacccggtcttattatttcatgggtaaggacaacatcacc
ttccattcgcagatttggcccgcggaattgctgggttaccaggggaaaggggctaaaggt
ggtcagctgcgtgcgtatggtgaattgaatctgccgaccgaagtggtttcgtccgaattt
ttgaccatgtctggatccaaattctcctcatccaagggtgtggtgatttatgtcaaggac
ttcttggcggaatttggtccagatccgctgcggtatttcattgctacggcaggcccggaa
aataacgacacggatttcacatgggacgaatttgtgcgtcgaatcaataatgaactcgca
aacgggtggggcaacttgattaaccgcacggtgtccatggcttataagaattttggtgtg
gttcctaccccgggcgagcttgtcgatgcggataaggcgatccttacaactgctgccgat
gcttttgaaacggttggccaggctataggccaatcacgtttcaaagaggggatcactaag
gcgatgcatgtggtcggggaggccaacgcctacatagcggagcaagaaccatggaaattg
gctaaggacgatacccaacgtgatcgcttggctacggttttgtggactgcattgcaggtg
gtctccgatattaatgtgctgctgactccgtatcttccgcatattgcccagtcggtgcac
gaaaccttgggccgaaccggggtgtgggccgcccaaccggaaattgtggaagtgattgat
gatatgccgaccgagccggtaggcgtggggctaccggaacagggggcgacctatccggtg
attatgggcgactacgctaaccagcaggcggtgtggcgccggatcgagatggtaccaggc
gtggaattgtccaagcctcaaccgctgattgccaagttagatccggaattggccgagacc
ggtcccacctgggcacccgtcgaaaagcagtaa

DBGET integrated database retrieval system