KEGG   Corynebacterium mustelae: CMUST_05230Help
Entry
CMUST_05230       CDS       T03941                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cmv  Corynebacterium mustelae
Pathway
cmv00071  Fatty acid degradation
cmv00072  Synthesis and degradation of ketone bodies
cmv00280  Valine, leucine and isoleucine degradation
cmv00310  Lysine degradation
cmv00362  Benzoate degradation
cmv00380  Tryptophan metabolism
cmv00620  Pyruvate metabolism
cmv00630  Glyoxylate and dicarboxylate metabolism
cmv00640  Propanoate metabolism
cmv00650  Butanoate metabolism
cmv00900  Terpenoid backbone biosynthesis
cmv01100  Metabolic pathways
cmv01110  Biosynthesis of secondary metabolites
cmv01120  Microbial metabolism in diverse environments
cmv01130  Biosynthesis of antibiotics
cmv01200  Carbon metabolism
cmv01212  Fatty acid metabolism
cmv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cmv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CMUST_05230
   00630 Glyoxylate and dicarboxylate metabolism
    CMUST_05230
   00640 Propanoate metabolism
    CMUST_05230
   00650 Butanoate metabolism
    CMUST_05230
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CMUST_05230
   00072 Synthesis and degradation of ketone bodies
    CMUST_05230
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CMUST_05230
   00310 Lysine degradation
    CMUST_05230
   00380 Tryptophan metabolism
    CMUST_05230
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CMUST_05230
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CMUST_05230
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CMUST_05230
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmv04147]
    CMUST_05230
Enzymes [BR:cmv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CMUST_05230
Exosome [BR:cmv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CMUST_05230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKK05384
UniProt: A0A0G3GW48
Position
1087025..1088200
Genome map
AA seq 391 aa AA seqDB search
MTHQGSDVVIVGAARTPFGKLLGGLSDIPATQLGAIAIRGALEQAKVPGDKVDAVIMGQV
LQAGVGQNPAKQAALGAGIQEEAHTLTINKVCLSGLTAVIDAARLLRTGEAQVVVAGGME
SMSLAPHLLVGARRGYKYGSAATEDHMAFDALSAAGSGESMGALTESFSLTYPLDRQEQD
ECAARSHQRAHAAHEAGLFDAEIVPVRTKAGELRADEGVRPDSSVLSLSGLRPAFTPDGT
ITAGNSSQITDGAAACVLTTRGMAEKTGWPILATVRAPGQIAGPDHSLQAKPARALEVAL
ARQGWDIADLDVVEINEAFAAVAIYSAKELGIDVETINTEGGAIALGHPVGASGARLVVH
AAHMLHQKRGTKAGLALCGGGGQGEALLLEA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaccaaggttctgatgttgtaatcgtaggggcggcacgaaccccatttgggaag
ttgctgggtggactatcggatatcccggccacacagctcggcgctatcgctatccgtggc
gccttggaacaggcgaaggtgccaggggataaggtcgacgcggtgatcatggggcaagtt
ctccaggcgggggtggggcaaaatccggctaagcaggcagcacttggcgcgggaatccag
gaagaggcacacaccttaactattaacaaggtgtgtctttccgggctgactgctgttatc
gacgcagcccggctacttcggaccggcgaagctcaggtagtagttgcaggtggaatggaa
tccatgtcgcttgccccgcacttacttgtaggggccaggcggggatataagtatgggtca
gcggcaaccgaagatcacatggccttcgatgcactatcggccgctggtagtggcgagtcc
atgggggcgcttactgaatcctttagtctgacatatcccctggatcggcaggaacaggat
gaatgtgcggcccgctcgcatcaacgcgcacacgctgcgcatgaagcggggctatttgat
gctgagatcgttccggtacggactaaagcgggtgaactgcgtgccgacgaaggtgtacga
cccgactcatccgttttaagcctaagcggtttgcggccagcttttactccagacgggacg
atcaccgccggaaactcatctcagatcaccgacggtgccgcagcgtgtgtgttaaccact
aggggcatggccgaaaaaaccggctggccgatattggcgacagtgcgcgcgccgggccag
atcgctgggccggatcattctttacaggccaagccagcacgtgcccttgaagtggccctg
gcgcggcaggggtgggatattgccgacctggatgtagtggagattaatgaggcctttgct
gcggtggcgatttacagtgcgaaggaattgggaattgatgtggaaactattaatacggag
gggggagcgattgcgttggggcatccggtcggcgcttcgggggctcggttggttgttcat
gcagctcacatgttgcatcaaaagcgcggcactaaggcggggttggcattgtgtgggggt
ggtgggcaaggggaagccttgctgttagaggcataa

DBGET integrated database retrieval system