KEGG   Cronobacter muytjensii: AFK63_02410Help
Entry
AFK63_02410       CDS       T04067                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cmw  Cronobacter muytjensii
Pathway
cmw00071  Fatty acid degradation
cmw00280  Valine, leucine and isoleucine degradation
cmw00310  Lysine degradation
cmw00362  Benzoate degradation
cmw00380  Tryptophan metabolism
cmw00620  Pyruvate metabolism
cmw00630  Glyoxylate and dicarboxylate metabolism
cmw00640  Propanoate metabolism
cmw00650  Butanoate metabolism
cmw00900  Terpenoid backbone biosynthesis
cmw01100  Metabolic pathways
cmw01110  Biosynthesis of secondary metabolites
cmw01120  Microbial metabolism in diverse environments
cmw01130  Biosynthesis of antibiotics
cmw01200  Carbon metabolism
cmw01212  Fatty acid metabolism
cmw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cmw00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AFK63_02410
   00630 Glyoxylate and dicarboxylate metabolism
    AFK63_02410
   00640 Propanoate metabolism
    AFK63_02410
   00650 Butanoate metabolism
    AFK63_02410
  Lipid metabolism
   00071 Fatty acid degradation
    AFK63_02410
   00072 Synthesis and degradation of ketone bodies
    AFK63_02410
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AFK63_02410
   00310 Lysine degradation
    AFK63_02410
   00380 Tryptophan metabolism
    AFK63_02410
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AFK63_02410
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AFK63_02410
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AFK63_02410
Enzymes [BR:cmw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AFK63_02410
Exosome [BR:cmw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AFK63_02410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III DUF840 ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ALB69523
UniProt: A0A0K2P9U9
Position
489609..490790
Genome map
AA seq 393 aa AA seqDB search
MKDVVIVGAARTPIGCFQGALASRSAVELGAVVIEALLGRTGINPQDVDEVILGQVLTAG
AGQNPARQTALNSGLPWAVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTEGRTGAPPENGHLIDSLVHDGLWDAFNDYHMGVTAENLAREYNISREHQDAWAL
ASQHKARAAIDSGRFRDEIVPVVIEQWQGAPLVVDTDEQPRADTSAEGLARLSPAFAHPG
SVTAGNASSINDGAAAVLMMSASKAQALGLPVLARIRAFASVGVDPALMGIAPVYATRRC
LERAGWRLDDIDLIEANEAFAAQTLSVGKLLEWDERKVNVNGGAIALGHPIGASGCRILV
SLVHEMVKRQARKGLATLCIGGGQGVALAIERD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtcgtcattgtgggggccgcgcgtacacctatcggctgttttcagggcgcg
ctggcgagccgttccgcggtggagctcggcgcggtcgttatcgaggcgctgctggggcgt
acaggcatcaatccacaggatgtcgatgaggtgatcctggggcaagtgctgacggcaggc
gccgggcagaacccggcgcgtcagaccgcgcttaacagcggtctcccgtgggctgtatcg
gctatcactattaacgacgtctgcggctccgggctgaaggcgctccatctggcgacacag
gcgattcagtgtggcgaggcggatgtggtgatcgcgggaggccaggagaatatgagccgc
gcgccgcatgtgctgaccgagggccgcaccggcgcgccgccggaaaatggccatctcatc
gacagcctggtgcatgacgggctgtgggatgcgtttaacgactatcacatgggcgtgacg
gcggaaaacctggcgcgcgaatataacatcagtcgcgagcatcaggacgcctgggcgctg
gcctcgcagcacaaagcgcgggcggccatcgacagcggccggtttcgtgatgagattgtg
ccggtggtcattgagcagtggcagggcgcgccattggttgtggataccgatgaacagccc
cgcgccgacaccagcgcggaagggctcgcgcgtttgtctcccgcctttgcacatcccggc
agcgtcacggcgggcaacgcctcatcgatcaacgatggcgctgccgcggtgctgatgatg
agcgccagtaaagcgcaagcgcttgggttgccggtgctggcccgtatacgcgccttcgca
agcgtcggggtcgatcccgcgctgatgggcatcgcgccggtatacgccacgcgccgctgt
ctggagcgtgcgggctggcggcttgatgatatcgatcttatcgaagccaatgaggcgttc
gcggcgcagaccctctcggtcggcaagctgctggagtgggacgagcgcaaagtgaacgtg
aacggcggcgcgattgcgctgggacatccgatcggtgcgtccggctgccgtattctggtc
tcgctggtgcatgagatggtaaaacgtcaggcccgtaaagggctggcgacgttatgtatc
ggcggtggtcagggcgtggcgctggctatcgagcgcgattaa

DBGET integrated database retrieval system