KEGG   Cronobacter muytjensii: AFK63_02700Help
Entry
AFK63_02700       CDS       T04067                                 

Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
cmw  Cronobacter muytjensii
Brite
KEGG Orthology (KO) [BR:cmw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cmw03016]
    AFK63_02700
Enzymes [BR:cmw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     AFK63_02700
Transfer RNA biogenesis [BR:cmw03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    AFK63_02700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ALB69578
Position
556864..557661
Genome map
AA seq 265 aa AA seqDB search
MSLEILWQDEWLVAVNKPSGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTAHRLDRPTSG
VLLMGLSSEVGRLLSQQFEHHQIQKRYHAIVRGWLTDSAILDYPLVEELDKIADKFSRQD
KEAQPAVTHYQGLATTTQPVAVGRYDSVRYSLIEMLPQTGRKHQLRRHMAHLRHPIIGDS
KHGDLRQNRAAAEHFGCNRLMLHASELALTHPVTGEPLVIRAGLDDVWHQALAHFGWQAH
LPDPVGVEFPGTNPQDENSLNPQGD
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctggagatcctctggcaggacgaatggctggtggcggtcaacaagccatccggt
tggctggtgcaccgcagctggctcgatcgcgacgaaaaagtggtcgttatgcagaccgtg
cgcgaccagataggccagcacgttttcaccgcccaccgtctcgacagacccacgtccggc
gttctgctgatgggcctgtcgagcgaggtcgggcggctgttatcacagcagtttgagcat
catcagatccaaaaacgctaccatgctatcgtgcgcggctggctcaccgacagcgcgata
ctcgattacccgctcgtggaagagctggataaaattgccgataaattctcgcgtcaggat
aaagaggcgcagccagcggtaacgcattatcaggggctcgcgaccaccacgcagccggtg
gcggtggggcgttatgattcagtgcgttactctttaatcgagatgcttccgcagactggt
cgcaagcatcagctgcgccgccatatggcgcacctgcgccatcctatcatcggcgactcg
aaacatggcgatctgcgccagaaccgcgccgcagcggagcatttcggctgcaaccggctg
atgcttcacgccagtgagcttgcgctcacgcaccccgtgaccggcgagccgctcgtcatt
cgcgctggtcttgacgatgtctggcatcaggcgctcgcgcactttggctggcaggcgcat
ctccccgatcccgttggggttgagtttcccggtacgaaccctcaggatgaaaatagtctg
aatccacaaggagattaa

DBGET integrated database retrieval system