KEGG   Cronobacter muytjensii: AFK63_11795Help
Entry
AFK63_11795       CDS       T04067                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
cmw  Cronobacter muytjensii
Pathway
cmw00260  Glycine, serine and threonine metabolism
cmw01100  Metabolic pathways
cmw01110  Biosynthesis of secondary metabolites
cmw01120  Microbial metabolism in diverse environments
cmw01130  Biosynthesis of antibiotics
cmw01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cmw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AFK63_11795
Enzymes [BR:cmw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AFK63_11795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ALB71264
Position
2540677..2541684
Genome map
AA seq 335 aa AA seqDB search
MIDLRSDTVTRPGNAMLARMMAAPTGDDVYGDDPTVNALQEYAAHLSGKEAALFLPTGTQ
ANLVALLSHCERGEEYIVGQLAHNYLYEAGGAAVLGSIQPQPIDANSDGTLPLDNVAAKI
KPDDVHFARTRLLSLENTHNGKVLPRDYLQQAWEFTRERGLALHVDGARIFNAVVAYGCE
LKDIAQFCDTFTICLSKGLGAPVGSLLLGSHEYIQRAKRWRKMTGGGMRQAGILAAAGLY
ALEHNVTRLKEDHDNAAWLAAALRDVGADVRRHDTNMLFIRVPPAQVAALGAFMKTRDVL
ISAAPVTRLVTHLDVNREQLETVVAYWREFLQQAA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgatttacgcagtgataccgtcacgcgccctggcaacgccatgctggcgcgtatg
atggcggcccccaccggggatgatgtctatggcgacgacccgaccgttaacgcgctgcag
gagtatgcggcgcacctgagcggcaaagaggcggcgctgtttctgcctaccggcacccag
gcgaacctggtggcgctgctgagtcactgcgagcgcggcgaggagtatattgtcggacaa
ctcgcgcacaattatctctatgaagccggcggcgcagcggtgctcggcagcattcagccg
cagccgattgacgccaacagtgacggcacgctgccgcttgataacgtcgcggcgaaaatc
aaacccgacgatgtgcacttcgcccgcacccgcctgttaagccttgaaaatacccataac
ggcaaagtactgccgcgcgattatcttcaacaggcgtgggaatttacccgcgagcgcggt
ctcgcgctgcatgtggacggcgcgcgcatctttaacgcagtagtggcgtatggctgcgag
ctgaaagatatcgcgcagttttgcgatacgttcacgatttgcctctccaaagggctcggc
gcgccggtgggctcgctgctgctcggcagccatgagtacattcagcgcgcaaaacgctgg
cggaaaatgaccggcggcggcatgcgtcaggccggtattctcgcggccgccgggctttat
gcgctggagcataacgttacgcgtctgaaagaggatcacgacaacgccgcctggcttgcc
gcggcgctgcgcgatgtgggcgcggatgtgcgtcgccacgacaccaatatgctgttcatc
cgcgtgccgccggcgcaggtcgccgcgctcggcgcgtttatgaaaacgcgcgacgtgctg
ataagcgccgccccggtgacgcgtctggtgacgcaccttgatgtcaaccgcgaacagctt
gaaaccgtcgtggcatactggcgggagtttttacagcaggcggcataa

DBGET integrated database retrieval system