KEGG   Cronobacter muytjensii: AFK63_13120Help
Entry
AFK63_13120       CDS       T04067                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cmw  Cronobacter muytjensii
Pathway
cmw00480  Glutathione metabolism
cmw00590  Arachidonic acid metabolism
cmw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    AFK63_13120
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AFK63_13120
Enzymes [BR:cmw01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AFK63_13120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ALB71506
Position
2828108..2828590
Genome map
AA seq 160 aa AA seqDB search
MTPFHQLTATSLRGELISMADYAGKVILVVNTASHCGFTPQYAGLEALYKKYAARGFIVL
GFPCNQFGNQEPGGADEIAQTCHINYGVSFPMFGKVAVNGAATHPLFRYLKDELPGVLGG
RIKWNFTKFLIGRDGKPLKRFAPFTPPEKMETVILAALGN
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaccccctttcatcaactgactgccaccagcctgcgtggcgagcttatctctatggcc
gactacgcgggcaaggtgattctggtggtgaataccgccagccattgtggcttcacgccg
caatacgcaggccttgaggcgctttataaaaagtatgccgcccgggggtttatagtgctt
ggttttccctgcaaccagttcggtaatcaggagcccggcggtgccgatgaaatcgcacag
acctgtcacatcaattacggtgtgagcttccccatgttcgggaaagtggcggtcaacggc
gcggctacgcacccgctgtttcgttacctgaaagatgaattgcccggcgtgctgggtggc
cggatcaagtggaacttcacgaagtttttgattggacgcgatggcaaaccactcaaacgt
tttgcgccgttcacgccccccgaaaaaatggaaaccgtcattcttgcggcgctgggaaac
tga

DBGET integrated database retrieval system