KEGG   Cronobacter muytjensii: AFK63_14900Help
Entry
AFK63_14900       CDS       T04067                                 

Definition
(GenBank) N-acetyl-anhydromuranmyl-L-alanine amidase
  KO
K03806  N-acetyl-anhydromuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
cmw  Cronobacter muytjensii
Brite
KEGG Orthology (KO) [BR:cmw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cmw01011]
    AFK63_14900
Enzymes [BR:cmw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     AFK63_14900
Peptidoglycan biosynthesis and degradation proteins [BR:cmw01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   AFK63_14900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase_2
Motif
Other DBs
NCBI-ProteinID: ALB71839
Position
complement(3233456..3234019)
Genome map
AA seq 187 aa AA seqDB search
MQVKDGWLVDARLAPSPHHDCRPEDEAPSLLVVHNISLPPGEFGGPWIDALFAGTLDPDA
HPYFAGIAHLRVSAHCLIRRDGEIVQYVPFNKRAWHAGVSCYQGRERCNDFSVGIELEGT
DTLAYTDAQYRQLAAVTRTLLALYPAMKGHMTGHSDIAPERKTDPGPAFDWQRFRALVAA
PSDKEMR
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgaaagatggctggctggtggatgccaggctcgcgccctcgccgcatcatgat
tgccgaccagaggacgaagcgccttcgttgctggtggtgcataacatcagcctgccgcca
ggggaatttggcggcccgtggattgacgcgctgttcgccggcacgcttgacccggacgca
cacccttattttgccggcatcgcccacctgcgtgtatcggcccactgcttgatccggcgc
gacggtgagattgtgcagtatgtgccttttaataaacgtgcctggcatgctggcgtatcc
tgctatcaggggcgcgaacgctgcaacgatttttctgtcggcattgagcttgaaggtact
gacacgctggcgtacaccgatgcgcagtaccggcagttggccgcggttacccgcacattg
ctggcgctgtatccggcgatgaaggggcatatgaccggtcacagcgatatcgcgcctgaa
cgtaaaaccgatcccggcccggcttttgactggcagcgctttcgcgccctggtggccgcc
ccgtctgataaggagatgagatga

DBGET integrated database retrieval system