KEGG   Cronobacter muytjensii: AFK63_16170Help
Entry
AFK63_16170       CDS       T04067                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
cmw  Cronobacter muytjensii
Pathway
cmw00052  Galactose metabolism
cmw00500  Starch and sucrose metabolism
cmw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AFK63_16170
   00500 Starch and sucrose metabolism
    AFK63_16170
Enzymes [BR:cmw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     AFK63_16170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: ALB72081
UniProt: A0A0K2PH98
Position
3520743..3522152
Genome map
AA seq 469 aa AA seqDB search
MTTRTLLPAILQAVMKGQPVALSDRHYPRWHLAPVTGLMNDPNGFIHFQGRYHLFYQWNA
LGCQHQHKCWGHWSSADLTHWRHEPLALMPDEEYDRSGCYSGSAVDDAGKLTLCYTGNVK
FDDGTRTAWQCLAVQNADGGFDKLGPVMPLPGGYTGHVRDPKVWRHAEHWYMVLGAQDLE
LQGKVLLLRSVNLWNWENLGEIAGSTLGGLGDAGYMWECPDLFMLDGKAILLCCPQGVAR
EEKRFLNTYPSAYLCGELDYEQPEYRHGPLVELDAGFEFYAPQTTLAEDGRRLLIGWMGV
PDGEEMLQPTVAQGWIHQMTCPRELSLRDGLLCQQPARELAALRGDEQRVEGAASALAPI
AAQSLELMLEAQGDVTLDFAGTLRLEWTRDGLRLSRRSLKSGEWLYRYWQGEAKRLHILC
DSSSVEIFINDGEGVMSSRYFPAASAMLAFDGGAQLRLRYWSLRPCMVE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgactacccgtacgctgctgcccgccattttacaggccgtgatgaaaggccagccggtc
gcgcttagcgatcgccactacccgcgctggcatctggcgcccgttacgggcctgatgaac
gacccgaacggttttatccattttcaggggcgttatcacctgttttatcagtggaatgcg
ctgggctgtcagcatcagcataagtgctgggggcactggagctcggcggatctgacgcac
tggcgtcacgagccgctggccctgatgccggatgaagagtatgaccgcagcggctgctat
tccggcagcgcggtggatgatgccggcaaactgacgctctgctacaccggcaacgtgaag
tttgacgacggcacgcgcaccgcgtggcagtgtctggcggtacagaacgccgatggcggc
tttgacaagctcggcccggtgatgccgctgcccggcggctacaccggccacgtgcgcgac
ccgaaagtctggcgtcacgcagaacactggtacatggtgctgggcgcgcaggacctggag
ctgcaaggcaaagtgttgctgctacgctccgtaaacctgtggaactgggaaaatctcggc
gagatagcgggcagcacgctcggcggactcggcgatgcgggttacatgtgggagtgcccg
gatctctttatgctggacggcaaagccattctgctctgctgcccgcagggcgtggcgcgc
gaagagaaacgctttcttaatacgtacccgagcgcgtatctgtgcggcgaactcgattac
gaacagccggaataccgccacggcccgctggtggagctggacgcgggttttgagttttac
gcgccgcaaacgacgcttgcagaagatggccgccggttgcttatcggctggatgggcgtg
ccggacggcgaggagatgctgcaaccgaccgtggcgcagggctggatccatcagatgacc
tgcccgcgcgaactctcacttcgcgacggcttgctctgccagcagccagcgcgcgaactg
gccgcgctgcgcggcgatgaacagcgcgtcgagggcgcggcatcggcgcttgcgcccatt
gcggcgcaaagcctggagctgatgctggaggcccagggcgacgtcacgcttgatttcgcc
ggaaccctgcgccttgaatggacacgggacggcctgcgcctttcgcgccgcagcctgaaa
agcggcgagtggctctaccgctactggcagggcgaggcgaaacgcctgcacattctgtgc
gacagctccagcgtcgagatcttcatcaacgacggcgaaggcgtcatgagcagccgctat
ttcccggcggccagcgcgatgctcgcctttgacggcggcgcgcaactccggctgcgctac
tggtcgttgcgcccttgcatggtagaatga

DBGET integrated database retrieval system