KEGG   Chelonia mydas (green sea turtle): 102929929Help
Entry
102929929         CDS       T02989                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
cmy  Chelonia mydas (green sea turtle)
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cmy01002]
    102929929
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmy04147]
    102929929
Enzymes [BR:cmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102929929
Peptidases [BR:cmy01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   102929929
Exosome [BR:cmy04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   102929929
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4
Motif
Other DBs
NCBI-GeneID: 102929929
NCBI-ProteinID: XP_007066062
Position
Un
AA seq 213 aa AA seqDB search
MAVKATAKDGVQLFVKAAGLRLSIRLTVDLPGLLIGLPQFLCFHAAQLLVPVVPRLLRPL
CNPLVDVPISMAGPVATNVARKLLEEKGIQVDLIVLESSFTNIREAAANIPITRIYRKFP
GFEYLILDSMALGDIFFRNDENVKVLSSPLLILHSEDDPVLPMHLGRKVTFLYAIALHSY
KNKDKVKFVAFPEKLGLAHENICSDPELPDIVK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgaaggccacggccaaggatggcgtgcagctctttgtaaaagcggcaggtctg
aggctcagcatcagattgactgttgacctccccggccttctgatcggcctgccgcagttc
ctgtgctttcatgcggcacagctgctggtccctgttgtgccccgtctcctgcgtcccctg
tgcaacccgctcgtagatgtccccatctccatggctgggccagtagcaacaaatgttgca
aggaaactgcttgaagaaaaaggcatccaggtggacttgatcgttctggaatcctcattc
accaacattcgggaggcagcagctaatatccccattaccagaatctaccgtaaattccca
ggattcgagtacttaatccttgactcaatggcgttgggtgacatatttttccgtaatgat
gagaatgttaaagtgctgtccagtccccttttgattttgcattcagaagatgaccctgtc
ttgcccatgcacctgggtagaaaggtaacttttctctatgctattgctctccactcctat
aagaacaaagacaaggtcaagtttgttgcctttccagagaagctgggcttagcccatgaa
aacatctgttcggatccagaactgccagacattgtgaagtaa

DBGET integrated database retrieval system