KEGG   Chelonia mydas (green sea turtle): 102930147
Entry
102930147         CDS       T02989                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
cmy  Chelonia mydas (green sea turtle)
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cmy03036]
    102930147 (ANKRD53)
Chromosome and associated proteins [BR:cmy03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    102930147 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank_4 Ank Ank_3
Other DBs
NCBI-GeneID: 102930147
NCBI-ProteinID: XP_007064082
Position
Un
AA seq 426 aa
MTHTAEIKEAFDKDLSKVIKGVPYQDKLIVLGDFNAPGFSAIHLAALYGRLECLKLIVEK
FEVDVNLASLTGWTPIHLVMNKESGPRALECLQYLIGKGADINVQNQGGTSPLHKAASEG
RLDCIIELVEAGADVHAKDAEGQQPIDLCRIWAYRSCARYLNDAMWKTDKRNFAREMHKL
NQIKSECQHLEQNFLKIEKGEQDLLNAVAFSNWLGTKQQQGLPDSAKRWHFPEDRAKLDA
VPKKEVAKIPPGEKKPSVHTKRRAKIKGEPRLSATAQPRTGKSQRAWNASVNPSSPRVTD
IFRPTTVRLGTNPEACGDHDFSSFLFLSKDSHGQPVIDMAYKGRLSPVPNLPYEVIEKSL
YPHARPIRLKMPQEFKPTHIFDVTRKRRPSLEHRWTDEMAVSLRETLDPAFRATLKAHLS
AVNDSS
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgactcatacagccgagatcaaggaggcatttgataaagatctcagcaaggtcatcaaa
ggggtgccataccaagacaaactcattgtcctaggagactttaatgctcctggcttctca
gccatccatctagcagctctatacggccggctggagtgcctgaaactgatagtcgaaaag
tttgaggttgatgtgaacttagccagtctgacaggatggacacccattcacctggtgatg
aacaaggagagtggccccagggcactggagtgtttgcagtacctcattggaaagggggca
gacatcaatgttcagaaccagggcggaacgtcgccacttcacaaggcagccagtgaagga
cgcctcgactgcatcattgaactggttgaggctggagctgatgtccacgccaaggacgca
gaggggcagcagcccattgacctctgcaggatatgggcctacaggagctgcgctaggtac
ctgaatgatgccatgtggaaaacagacaagcgcaattttgctcgcgaaatgcacaagctg
aatcaaatcaaaagtgaatgtcagcacttggaacaaaatttcctgaagatagagaagggg
gagcaggacttgttgaatgcagtggcattctctaactggcttggaacgaagcagcaacag
gggttgcctgactctgctaaacggtggcattttccagaggacagagcgaagctggatgct
gtccccaagaaggaagtggctaaaatacctcctggagaaaaaaaacccagcgtgcacacc
aagcggagggctaagattaaaggggaacctcgtttatctgccactgctcagccccgcact
gggaaatcacagcgagcttggaatgccagcgtcaatccatcctcccctcgggtgacagac
atattccgacctacaacagtccggctgggcaccaaccccgaggcctgtggggatcatgac
ttcagctccttcttgtttctctccaaggactcgcacggacagccggtgatcgacatggct
tacaaaggcagactctcccccgtccccaacctgccctatgaagtgatcgagaaaagcctg
tatccccacgctcggcccatcagattaaagatgccgcaagaatttaaacccacacacatc
ttcgatgtgacaaggaagcgccgcccaagcctggagcacaggtggacggacgaaatggct
gtgagcttgcgggaaactctggacccagcattcagagctacgctaaaggctcacctctct
gcagtcaacgacagcagttag

DBGET integrated database retrieval system