KEGG   Chelonia mydas (green sea turtle): 102930175Help
Entry
102930175         CDS       T02989                                 

Gene name
CDK15
Definition
(RefSeq) cyclin dependent kinase 15
  KO
K15594  cyclin-dependent kinase 15 [EC:2.7.11.22]
Organism
cmy  Chelonia mydas (green sea turtle)
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cmy01001]
    102930175 (CDK15)
Enzymes [BR:cmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     102930175 (CDK15)
Protein kinases [BR:cmy01001]
 Serine/threonine kinases: CMGC group
  CDK family
   102930175 (CDK15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 102930175
NCBI-ProteinID: XP_007071913
Position
Un
AA seq 435 aa AA seqDB search
MGEALCVNALKPGSCCCCSERKGSQRSQSTQSVEVESMMELPDLSRVPHPMDSLQSQWFQ
TLQLQKSGRKRPRSNSDPSQEMDFVKRFQWQRQGLPFGTASSYLNLEKLCEGSYSTVYKG
ISRINGHLVALKVISLETEEGVPFTAIREASLLKSLKHANIVLLHDIIQTKDTLTFVFEY
MHTDLAQYMAQHPGGLHAHNVMLFMFQLLRGLAYIHQHHILHRDLKPQNLLISCLGELKL
ADFGLARAKSIPSQTYSSEVVTLWYRPPDVLLGATDYSSGLDIWGAGCILIEMLQGQPVF
PAVTGTLEQLEKIWAVLGVPTEDTWPGLSKLPNYKPERVVSCRPQRLRMICARLGQVPGA
EDLALKMLKAFPRERVSAQDALVHNFFSALPSRLHQLRDAQSLFTVPGVRLQPEICDLFA
PYQKGHRQASSSKFW
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgggggaagcactgtgtgtaaatgctctcaaacctggatcatgctgttgctgttcagag
agaaagggctctcaacgcagccagagtacccagtctgtggaagtggagtctatgatggag
ttaccagatctgagcagagtgccacatcccatggattcactccaatcacagtggttccaa
acactccagctacaaaagtctgggagaaagagaccacggagtaacagcgatccttcccag
gagatggattttgtgaagagattccagtggcagagacagggcctcccgtttggaacagcc
tcatcctacctgaatctggagaagctgtgtgaaggttcttactctacagtttacaagggg
attagcagaataaatggccacttggtggctttgaaagtaatcagtctggagacagaggaa
ggagtgccttttaccgccatccgagaagcatctcttctcaagagtctgaaacacgccaat
attgtgctcctgcacgacattatccagacaaaggacactctgacatttgtcttcgagtac
atgcacacagatctggcacagtacatggcccagcatcctggaggacttcatgctcacaat
gtcatgctcttcatgttccaacttttgcgaggcctggcttacatccaccaacaccacatt
cttcatcgtgatctgaaaccccagaacttgctcatcagttgcctcggcgagctcaaatta
gctgactttggtcttgctcgtgccaagtccatccccagtcagacatactcctctgaggtg
gtgacgctctggtaccgtcctcctgatgtcctactcggagccactgattattcttctggt
ttggatatctggggtgcaggttgtatattgattgaaatgctccagggtcaacccgtgttc
ccagcagttactggtactctggaacagctggagaagatctgggcagtgttgggggtccca
actgaggatacctggccaggactttccaagcttcccaactataaaccagagagggtcgtc
tcctgtagacctcagaggctccgaatgatctgtgccaggctgggccaggtgccaggagct
gaagacctcgcattgaaaatgttaaaagcttttcctcgagagcgggtctctgcacaggat
gcacttgttcataacttcttcagcgctctgccctctcggctgcatcagcttcgtgatgca
cagtcactgtttacagttccgggagtgaggctgcagccagaaatctgtgacctatttgct
ccttaccaaaagggtcatcgccaagccagttcaagcaagttttggtga

DBGET integrated database retrieval system