KEGG   Chelonia mydas (green sea turtle): 102930229Help
Entry
102930229         CDS       T02989                                 

Gene name
NT5C1A
Definition
(RefSeq) 5'-nucleotidase, cytosolic IA
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy00230  Purine metabolism
cmy00240  Pyrimidine metabolism
cmy00760  Nicotinate and nicotinamide metabolism
cmy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102930229 (NT5C1A)
   00240 Pyrimidine metabolism
    102930229 (NT5C1A)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    102930229 (NT5C1A)
Enzymes [BR:cmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     102930229 (NT5C1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 5-nucleotidase
Motif
Other DBs
NCBI-GeneID: 102930229
NCBI-ProteinID: XP_007067679
Position
Un
AA seq 331 aa AA seqDB search
MERFFNSWPKPENAITIAVSSRALFRMEEEQKIYTEQGVEAYVKYQLDHENEPFLPGAAF
PFVKALEAVNTQLRELYPDGEELFDIVLMTNNHAQVGVRLINSINHHDLFIERFCMTGGN
SPTCYLKAYHTNLYLSSDAEKVSEAIEQGIAAATMFSPSKDVKVSESQLRVAFDGDAVLF
SDESEQIVKAHGLDMFFEHEKAYENKPLAQGPLKGFLESLGKLQKKFYSKGLRLECPIRT
YLVTARSAASSGARALKTLRSWGLETDEALFLAGAPKGPLLEKIRPHIFFDDQMFQVEGA
KESGTIAAHVPYGIAQKQRRMAQEKQTKNSK
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggagaggtttttcaacagttggccaaagcctgagaatgcaataacaatcgcagtctcc
tcgcgggctctgtttcgcatggaggaagagcagaagatttacacagagcaaggggtggag
gcgtatgtgaaataccagctggaccatgagaatgaacccttcctacccggcgctgccttc
ccatttgtcaaggctcttgaagctgtcaacactcagttgcgagagctctaccccgacggt
gaagaactctttgatattgtcctcatgactaataaccacgcccaggtcggggtccgcctg
attaacagcatcaatcatcacgatctgttcatcgagaggttctgcatgacgggagggaac
agccccacttgctacctgaaggcctatcacaccaacctgtacctctcctctgatgccgag
aaagtgagtgaggccattgaacagggaatcgccgcagccaccatgttcagccccagcaaa
gacgtgaaagtgtcagagagccagctgcgggtggcgttcgacggggacgccgtcctcttc
tcggacgagtcggagcagattgtgaaggcgcacggcctcgacatgttttttgaacacgaa
aaggcttatgagaacaagccgctggcccaggggccactgaagggctttctggaatctctg
gggaagctgcagaagaagttctactccaaggggctgagactggagtgtccgattcgcacc
tacctggtcactgcccggagcgctgccagctctggggctcgtgccctaaagactctccgc
agctggggactagaaacggacgaagccctgttcctggccggagcccccaagggtccgctg
ctggagaagatccgtccgcacatcttcttcgacgaccagatgttccaggtggagggggcg
aaggagagtggcaccatcgcggcccacgtcccgtacggcatagcccagaagcagaggcgg
atggcgcaagagaaacaaaccaagaacagcaagtag

DBGET integrated database retrieval system