KEGG   Chelonia mydas (green sea turtle): 102930287Help
Entry
102930287         CDS       T02989                                 

Gene name
RASSF5
Definition
(RefSeq) Ras association domain family member 5
  KO
K08015  Ras association domain-containing protein 5
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102930287 (RASSF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nore1-SARAH RA Mst1_SARAH
Motif
Other DBs
NCBI-GeneID: 102930287
NCBI-ProteinID: XP_007065151
Position
Un
AA seq 312 aa AA seqDB search
MTQGKAEAAACFGVVTKRIRKIFRHFPKSKSWSEGLHLLRRPSREVLLVKDCKYTCHQEC
RSLIQLDCSQQGQPRNKPSPENTLTQNCSQNVTKTAEEEKPRAPTIQEIEQIINSYNAKV
TNCFVMKLSAHHVYHWVKYCKKPSSWRAGIRPPSIYDALKEVNLADMTDKRTSFYLPLDA
VKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFALFKEMQRDGQVLFQKLSLTEYPLYLRL
LAGPDTDVLSFVLKENETGEVEWDAFSIPELQNFLTILDREEKDKIQQVQKKYSKFKQRL
EESLKEAGGKPG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgacacaggggaaagcagaggcagccgcttgctttggggttgtaacaaagagaatacgc
aagatattcaggcattttcccaagtcgaaatcttggtccgagggtctccacctactgcgg
aggcccagcagggaggtcttactggttaaagattgcaaatatacctgccatcaggaatgc
agaagcctgattcagctggactgcagccaacaaggacagcccaggaacaaaccctcgcca
gaaaatacactgacgcaaaactgcagccagaatgtaacaaaaacagcagaagaagaaaaa
cccagagctcccactatccaggagattgaacagataatcaatagttacaatgccaaggtt
acaaactgcttcgtgatgaagctgtcagcccaccatgtctaccactgggttaagtactgc
aaaaagccctccagctggagagcaggaattcggccgccgtctatctatgatgccctcaag
gaggtgaacctggctgatatgacggacaagagaacttccttctacttgccgctggatgca
gtcaagcagctgcacatcagcagcacgaccacggtcagcgaggtgatccaggggctcctc
aagaagttcatggtggtggacaaccctcagaagtttgcacttttcaaggaaatgcagaga
gatgggcaagttctcttccagaagctctctctaacagaataccccttgtatctccggctg
ctggctggccccgacacagatgttctcagttttgtgctgaaggagaacgaaacgggggaa
gttgagtgggatgcattctctatcccagagctacaaaatttcttaacgatactggacaga
gaggaaaaagacaaaattcagcaagtccaaaagaagtacagcaagtttaaacaaagactg
gaggagagtttgaaagaagcaggaggaaaaccaggataa

DBGET integrated database retrieval system