KEGG   Chelonia mydas (green sea turtle): 102930354Help
Entry
102930354         CDS       T02989                                 

Gene name
TCEA2
Definition
(RefSeq) transcription elongation factor A2
  KO
K03145  transcription elongation factor S-II
Organism
cmy  Chelonia mydas (green sea turtle)
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cmy03021]
    102930354 (TCEA2)
Transcription machinery [BR:cmy03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription elongation factors
     102930354 (TCEA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIS_M TFIIS_C Med26 DBD_Tnp_Mut
Motif
Other DBs
NCBI-GeneID: 102930354
NCBI-ProteinID: XP_007062586
Position
Un
AA seq 274 aa AA seqDB search
MDLLKELKSMPITLDLLQSTRIGMSVNALRKQSTDDEVISLSKSLIKSWKKLLDASEDKS
EEKRRNSSLSASSSKESGDSRDQSSNKRQDPPKTPTTPKITTFPPVPVTCDAVRNKCREM
LTSALQTDNDYVAIAADCEHLSGQIEECIYQDVKNTDMKYKNRVRSRISNLKDSKNPELR
KNVLCGAITPEQIAVMTSEEMASNELKEIRKAMTKEAIREHQIARTGGTQTDLFTCGKCK
KKNCTYTQVQTRSSDEPMTTFVACNECGNRWKFC
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggatttgctgaaggaactgaaaagtatgcctataactctggacctcttgcagtccacc
cggattgggatgtcggtgaatgcgctgaggaagcagagcactgacgatgaagtgatatcg
ctttccaaatcacttatcaagtcctggaaaaagcttctcgatgcttcagaggacaaaagt
gaggagaagaggaggaattcttccttgtcggcatcctcctcaaaggagagcggtgactcg
agagaccaaagctccaacaaaaggcaggacccgccgaagactccgaccacacccaaaatc
accacctttccgccggtgcccgtcacctgtgacgctgtccgcaacaaatgcagagaaatg
ctgacttctgctctgcagaccgacaatgactacgttgccattgctgctgactgtgagcac
ctctctggccagattgaagaatgtatataccaagacgtcaagaacaccgacatgaagtac
aaaaaccgcgtgaggagccgcatctccaacctgaaggactccaaaaaccctgagctgaga
aagaatgtgctgtgtggagcaatcaccccggagcagatcgcggtgatgacctcagaggaa
atggccagtaacgagctgaaggagatcaggaaagccatgacgaaggaagcgatccgggag
caccagatagctaggacgggagggacccagaccgacctcttcacctgtgggaagtgcaag
aagaagaactgcacttacactcaggtgcagacccgcagctctgacgagcccatgaccacc
ttcgtcgcgtgcaacgagtgtgggaaccgctggaagttctgttga

DBGET integrated database retrieval system