KEGG   Chelonia mydas (green sea turtle): 102930932Help
Entry
102930932         CDS       T02989                                 

Gene name
ACVR2B
Definition
(RefSeq) activin A receptor type 2B
  KO
K13596  activin receptor type-2B [EC:2.7.11.30]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy04060  Cytokine-cytokine receptor interaction
cmy04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    102930932 (ACVR2B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102930932 (ACVR2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cmy01001]
    102930932 (ACVR2B)
Enzymes [BR:cmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     102930932 (ACVR2B)
Protein kinases [BR:cmy01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   102930932 (ACVR2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Activin_recp Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 102930932
NCBI-ProteinID: XP_007059493
Position
Un
AA seq 512 aa AA seqDB search
MIASWLTFAFLCGTFCAGPGHGEAETRECIYYNANWELEKTNQSGVERCEGEKDKRLHCY
ASWRNNSGSIELVKKGCWLDDFNCYDRQECVATEENPQVFFCCCEGNYCNEKFTHLPEVT
GPEVIYEPPPPTPSLLNILVYSLLPIAVLSVAILLAFWMYRHRKPPYGHVDINEDPGPPP
PSPLVGLKPLQLLEIKARGRFGCVWKAQLMNDYVAVKIFPIQDKISWQSEREIFNTPGMK
HENLLQFIAAEKRGTNLEMELWLITAFHDKGSLTDYLKGNIISWNELCHVAETMAHGLSY
LHEDVPWCKGEGHKPAIAHRDFKSKNVLLKNDLTAVLADFGLAVRFEPGKPPGDTHGQVG
TRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELISRCTAADGPVDEYMLPFEEEIGQ
HPSLEDLQEVVVHKKMRPAFKDHWLKHPGLAQLCVTIEECWDHDAEARLSAGCVEERISQ
IRKSVNGTTSDCLVSIVTSVTNVDLPPKESSI
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgattgcttcgtggttgactttcgcctttctttgtggaactttctgtgcagggccaggt
catggggaggcagagacgagagaatgcatctactacaatgccaactgggagctggagaag
accaatcagagtggcgtggaacgctgtgaaggagagaaggacaaacggctccattgctat
gcttcttggagaaacaactctggctccattgagttggtgaagaaaggctgctggttagat
gacttcaactgctatgacaggcaagaatgtgtagccacagaagagaaccctcaagtgttt
ttctgctgctgtgaggggaactattgcaatgagaaatttacgcatttacctgaagtaact
ggtccagaagtaatatatgagccaccaccaccaacaccctcactactcaacattctggtt
tactctctgcttccaatcgctgttctgtcagtggccattctcttggccttctggatgtac
cgtcaccgaaagcccccctatgggcacgttgacattaatgaggaccctggtccaccaccc
ccttctccattggttggccttaagcctttgcaattattggagatcaaagctagggggcgc
tttggctgtgtctggaaggctcagctgatgaatgactatgtagcagtgaaaatcttcccc
atacaggataaaatatcctggcagagtgagagagaaatcttcaacacccctggcatgaag
cacgaaaaccttttgcagtttattgcagcagagaagcgaggaacaaacctggagatggag
ctatggctgatcacagctttccatgacaagggctctctgacagattacctgaaggggaat
attatcagctggaatgaactctgccacgttgcagaaacaatggcccatggactgtcctac
ctacatgaagatgtcccctggtgtaaaggggaaggacacaaacctgccatagcacacagg
gacttcaagagtaaaaatgtgttgttgaagaatgacttgacagcagttctagctgacttt
ggactggctgtacggttcgagcctggaaaacctccaggggacacccatggacaggtggga
acaaggaggtacatggctcctgaggtgttagagggggcaatcaacttccagcgagatgcc
ttcctgagaatagacatgtatgcaatgggactagtattgtgggagttaatctccaggtgc
acagcagctgatggtccagtagatgagtatatgctgccttttgaagaggagataggtcag
catccatcccttgaggacctgcaggaagtggtggttcacaaaaagatgcggcctgctttc
aaggatcactggctgaaacaccctggtttggcacagctctgtgttacgattgaagaatgc
tgggaccacgatgcagaggctcggctttcggcaggctgtgtcgaggagcgcatttctcag
atccgtaaatcagtaaacggcactacctcggactgcctcgtttccatcgtgacatctgtc
accaacgtggacttgccacccaaagagtctagtatctaa

DBGET integrated database retrieval system