KEGG   Chelonia mydas (green sea turtle): 102931552Help
Entry
102931552         CDS       T02989                                 

Gene name
PARP10
Definition
(RefSeq) poly(ADP-ribose) polymerase family member 10
  KO
K15261  poly [ADP-ribose] polymerase 10/14/15 [EC:2.4.2.30]
Organism
cmy  Chelonia mydas (green sea turtle)
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102931552 (PARP10)
Enzymes [BR:cmy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     102931552 (PARP10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP UIM
Motif
Other DBs
NCBI-GeneID: 102931552
NCBI-ProteinID: XP_007066848
Position
Un
AA seq 305 aa AA seqDB search
MDSQRWEEEELQRATELSLRSYEQEQHQASAEPAPDRSLQAALQESLEEALCVAGSARLT
IYSAYEQDLERTVPELGVQNSAVSNLRLLRASLHGTTEEKGPALDLDEAVKLVPLGQGSE
EFRDTVRRFYDTLEDFHNKIRIVKVEKLIHPLLYKQYQLKKACMEKACGHEAVERLLFHG
TTEEASREICQHGFNRSFCGKNATLYGHGVYFAVNAVLSVQEQYSPRSADGNKYVFVAMT
LTGDYTAGSRDMRAPPLKEAAEAPLRYDSVVDNPKKPAIFVIFNDTQAYPQYLITCQLSK
PPAPR
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggacagccagcgctgggaggaggaggagctgcagcgcgccacggagctgtccctgcgc
tcctacgagcaggagcagcaccaggcctcggcggagcccgcgcctgaccgcagcctgcag
gccgccctgcaggagtccctggaggaggcgctgtgcgtggccggctccgctcggctcacc
atctactcggcctacgagcaggacctggagcgcaccgttcctgagcttggggtccagaac
agtgcagtgtccaacctgcgtctcctccgggcctcgctccatggcaccacggaagagaag
ggccccgcgctggacctggacgaggcggtgaagctggtgccgctgggccagggctcggag
gagttccgcgacaccgtgcgtcggttctacgacacgctggaggacttccacaacaagata
cgcattgtgaaggtggagaagctgatccacccgctgctgtacaagcagtaccagctgaag
aaggcctgcatggagaaggcgtgcggccacgaggccgtggagcgcctcctcttccacggc
accacggaggaagccagccgggagatctgccagcacggcttcaaccgcagcttctgcggc
aagaacgccacgctctacgggcacggggtgtacttcgcggtcaatgccgtgttgtcggtg
caggagcagtactctccacgcagcgccgatggcaacaaatacgtcttcgtggccatgacc
ctgactggggactacacggcgggcagccgggacatgcgggcgccacccctcaaggaggca
gccgaggccccgctgcgctatgacagcgtggtcgacaaccccaagaagccggccatcttc
gtcatcttcaatgacacgcaggcctatccgcagtacctcatcacctgccagctgtccaag
cctccggcgccccgctga

DBGET integrated database retrieval system