KEGG   Chelonia mydas (green sea turtle): 102931552
Entry
102931552         CDS       T02989                                 

Gene name
PARP10
Definition
(RefSeq) poly(ADP-ribose) polymerase family member 10
Organism
cmy  Chelonia mydas (green sea turtle)
SSDB
Motif
Pfam: PARP UIM DUF5791
Other DBs
NCBI-GeneID: 102931552
NCBI-ProteinID: XP_007066848
Position
Un
AA seq 305 aa
MDSQRWEEEELQRATELSLRSYEQEQHQASAEPAPDRSLQAALQESLEEALCVAGSARLT
IYSAYEQDLERTVPELGVQNSAVSNLRLLRASLHGTTEEKGPALDLDEAVKLVPLGQGSE
EFRDTVRRFYDTLEDFHNKIRIVKVEKLIHPLLYKQYQLKKACMEKACGHEAVERLLFHG
TTEEASREICQHGFNRSFCGKNATLYGHGVYFAVNAVLSVQEQYSPRSADGNKYVFVAMT
LTGDYTAGSRDMRAPPLKEAAEAPLRYDSVVDNPKKPAIFVIFNDTQAYPQYLITCQLSK
PPAPR
NT seq 918 nt   +upstreamnt  +downstreamnt
atggacagccagcgctgggaggaggaggagctgcagcgcgccacggagctgtccctgcgc
tcctacgagcaggagcagcaccaggcctcggcggagcccgcgcctgaccgcagcctgcag
gccgccctgcaggagtccctggaggaggcgctgtgcgtggccggctccgctcggctcacc
atctactcggcctacgagcaggacctggagcgcaccgttcctgagcttggggtccagaac
agtgcagtgtccaacctgcgtctcctccgggcctcgctccatggcaccacggaagagaag
ggccccgcgctggacctggacgaggcggtgaagctggtgccgctgggccagggctcggag
gagttccgcgacaccgtgcgtcggttctacgacacgctggaggacttccacaacaagata
cgcattgtgaaggtggagaagctgatccacccgctgctgtacaagcagtaccagctgaag
aaggcctgcatggagaaggcgtgcggccacgaggccgtggagcgcctcctcttccacggc
accacggaggaagccagccgggagatctgccagcacggcttcaaccgcagcttctgcggc
aagaacgccacgctctacgggcacggggtgtacttcgcggtcaatgccgtgttgtcggtg
caggagcagtactctccacgcagcgccgatggcaacaaatacgtcttcgtggccatgacc
ctgactggggactacacggcgggcagccgggacatgcgggcgccacccctcaaggaggca
gccgaggccccgctgcgctatgacagcgtggtcgacaaccccaagaagccggccatcttc
gtcatcttcaatgacacgcaggcctatccgcagtacctcatcacctgccagctgtccaag
cctccggcgccccgctga

DBGET integrated database retrieval system