KEGG   Chelonia mydas (green sea turtle): 102932067Help
Entry
102932067         CDS       T02989                                 

Gene name
CPT2
Definition
(RefSeq) carnitine palmitoyltransferase 2
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy00071  Fatty acid degradation
cmy01212  Fatty acid metabolism
cmy03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102932067 (CPT2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102932067 (CPT2)
Enzymes [BR:cmy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     102932067 (CPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf Tri3
Motif
Other DBs
NCBI-GeneID: 102932067
NCBI-ProteinID: XP_007062265
Position
Un
AA seq 652 aa AA seqDB search
MTNSLRARGTPAVPGLRRGYSSADSSQYLHLSIVPTMHFQKSLPRLPIPKLEDTVRRYLN
AQKPLLDDDQFRKTEELACSFEHGIGRELHEQLVAQDKQNKRTSYISGPWFDMYLSSRES
VVLNFNPFMSFNPDPKAEYNDQLTRATNMTVSAMRFLKTLRAGYLEPEVFHLNPDKSDTQ
TFRRLIRFVPSSLSWFGAYMVNAYPLDMSQYFRLFNSTRLPKLSRDELFTDEKAKHLLVL
RNGNFYVFDVIDRDGNIVKPSEIQAHLKYILSDNSAAPAFPLAYLPSENRDIWALLRQKL
LDNGNEEVLQKVDSAVFCLCLDDFPIKDLVHLSHTMLHGDGINRWYDKSFNLILTKDGNA
AIHFEHSWGDGVAVLRFQNEVFKDSTQKPAVTPQSQPAAVDSSSAVQKLSFKLNDALKAG
ITKAKQNFDATMETLTLDFIQFKKGGKEFLKQKKVSPDAVAQLSFQMAFLRQYGQTVATY
ESCSTAAFKHGRTETIRPASIYTKKCTEAFVRQPSKHSTEELQQMIAECSKYHGQLTKEA
AMGQGFDRHLFSLRYLAASKGIPLPDVYQDQAYAQLNHNILSTSTLSSPAVNMGGFAPVV
PDGFGVAYGVHDDWIGCNTSSYPARNVHEFLQCVHKSLEDIFHVLEGKHINS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgactaattccttgagggcccggggcactccggcggtccccgggctgcggaggggctac
agcagcgccgactcctcccagtacctgcacctcagcatcgtgcccaccatgcacttccag
aaaagcctgcccaggttgccaattcccaaactagaagatactgttaggaggtacctgaat
gcccaaaagcctctcctagacgatgatcaattcaggaaaactgaagaacttgcttgcagc
tttgaacatggaattggaagagaattgcatgagcaactggttgctcaagacaagcagaac
aaacgtactagttacatctcaggtccctggtttgatatgtatctaagttcacgtgaatct
gttgttttgaattttaacccatttatgtccttcaaccctgacccaaaagctgaatataat
gatcagctcacacgagcaactaacatgactgtttctgctatgcgttttttgaagaccctc
agggctggctatctagagccagaggtttttcacctcaatccagacaaaagtgacactcaa
acctttaggagactcatccgatttgtgccttcatctctctcatggtttggtgcctacatg
gtcaatgcataccccttagatatgtctcagtacttccggcttttcaattccacacgattg
cctaagctcagtcgagacgagctttttacagatgaaaaagcaaagcacttgctggtgctc
agaaatgggaatttttatgtatttgatgtcattgatagagatgggaatatagtgaagcct
tccgaaatacaagcacacctgaaatacatacttagtgacaacagtgcagccccagccttc
cctcttgcatatttacccagtgaaaaccgagatatatgggcactactgagacagaagctt
cttgataatggtaatgaggaagtcctccaaaaagtggattctgctgtcttctgtctatgt
ttagatgacttccccattaaagatcttgtgcacttgtcccacaccatgttacatggagat
ggtattaatcgctggtatgacaaatcctttaaccttatcctaaccaaagatggcaatgcg
gccattcattttgaacattcctggggagatggtgtggctgtgttaagatttcagaacgaa
gtgtttaaagacagcacccagaagccagctgtcaccccacaatctcaacctgctgcagtt
gactcttccagtgctgtgcagaaactcagctttaagttgaacgatgccttaaaagcagga
attaccaaagccaaacagaactttgatgccactatggaaaccttgactcttgattttatt
cagtttaagaaaggaggcaaggagtttttaaagcagaagaaggtaagtcctgatgctgtg
gctcagctttctttccagatggctttccttcggcagtatggccagactgttgccacgtac
gagtcttgcagtactgcagctttcaaacacggtcgcacagagaccatccgtcctgcctcc
atctatacaaagaagtgcacggaagctttcgtcaggcagccttccaaacacagcacagag
gagcttcagcagatgattgctgagtgctcaaagtatcacggccaattgacaaaagaagct
gctatgggtcaaggatttgaccggcatttgtttagtttgcgttatttggcagcatcaaaa
ggtatcccattacctgacgtctaccaggaccaagcgtatgctcagcttaatcacaacatt
ctgtccacaagcacattgagcagcccagctgtgaatatgggaggatttgctccagtggtg
ccggatggctttggtgtagcctatggcgtgcatgatgattggattggctgcaatacttcc
tcttacccagccaggaatgtgcacgaattcctccagtgtgtgcataagtcactggaagat
atttttcatgttttagaaggtaagcatatcaatagttag

DBGET integrated database retrieval system