KEGG   Chelonia mydas (green sea turtle): 102932193
Entry
102932193         CDS       T02989                                 

Definition
(RefSeq) N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming)-like
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
cmy  Chelonia mydas (green sea turtle)
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102932193
Enzymes [BR:cmy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     102932193
SSDB
Motif
Pfam: AstE_AspA
Other DBs
NCBI-GeneID: 102932193
NCBI-ProteinID: XP_007055922
UniProt: M7CF51
Position
Un
AA seq 310 aa
MAASCRLKPLSRVAVSGGTHGNEMSGVYLAKHWLRDPMELQPDSFAVTPFLGNPCAIEKC
VRYVGRDLNRTFTTEFLSSAEAEDEPYEVVRARKINQTYGPKGSAQAFDFMFDLHNTTAN
MGACLIVDSEESLLPMHMCHYIQTHYTRSPCPIYLYKLPGEETYSINSVAKAGLALELGP
QPQRVVRADLFAQMRALMACALDFIELFNKGTVFPAFEIEAYKITGLMDYPCYPDGEISA
MVHPKLQDKDFLPLNPGDPIFQTFSGEEILYKGNTTIYPAFINEAAYYEKKVAFAKMEKH
TFSIPGLQRE
NT seq 933 nt   +upstreamnt  +downstreamnt
atggcagcctcttgccgtctcaagcccttgagccgtgtggccgtgagtgggggcacccat
ggcaacgagatgtcgggcgtctacctggccaagcactggctgcgggaccccatggagctg
cagcctgacagctttgccgtcacgcccttcctgggcaacccgtgtgccattgagaagtgt
gtgcggtatgtggggcgggatctgaaccgcaccttcaccaccgagttcctcagctccgca
gaggcagaggacgagccctacgaggtggtccgggcccgcaagatcaaccagacctacggc
cccaagggctcagcccaggcctttgacttcatgtttgacctgcacaacaccacagccaac
atgggcgcctgccttatcgtggactcagaggagagcctgctgcccatgcacatgtgccac
tacatccagacgcactacacacggagcccctgtcccatctacctgtacaagttgccaggc
gaggagacttactctatcaactcggtggccaaagccgggctagcgctggagctggggcca
cagccccagagggtggtgagagctgacctgtttgctcagatgagagccctcatggcctgc
gcactggacttcattgaactctttaacaagggcacagtgttccctgcctttgagattgaa
gcctacaagatcaccgggctcatggactatccctgctaccctgatggggagatctcagcc
atggtgcatcccaagctgcaggataaggatttcctccccttgaatcccggggacccaatc
ttccagaccttcagtggggaggagatcctgtacaagggcaacaccaccatctacccggcc
ttcatcaacgaggctgcctattatgagaagaaggtggcctttgccaagatggagaagcac
acattctccatccctggcctgcagcgagaatga

DBGET integrated database retrieval system