KEGG   Chelonia mydas (green sea turtle): 102932563Help
Entry
102932563         CDS       T02989                                 

Gene name
CACNG7
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit gamma 7
  KO
K04872  voltage-dependent calcium channel gamma-7
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy04010  MAPK signaling pathway
cmy04260  Cardiac muscle contraction
cmy04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102932563 (CACNG7)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102932563 (CACNG7)
   04261 Adrenergic signaling in cardiomyocytes
    102932563 (CACNG7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cmy04040]
    102932563 (CACNG7)
Ion channels [BR:cmy04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102932563 (CACNG7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 102932563
NCBI-ProteinID: XP_007053699
Position
Un
AA seq 146 aa AA seqDB search
PPAALLLALSLAGLSLVVGLVLYISSINDEVMNRPSGSEQYFHYRYGWSFAFAASSFLLK
EGAGVMSVYLFTKRYAEEEMYRPHPAFYRPRLSDCSDYSGQFLHPEVWHRGRSPSDISSD
VSIQMTQNYPPAIKYPEHMHISTSPC
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
cccccagcagctttattgttggccctgtctcttgcaggcctgtctctcgtggtggggtta
gttctctacatctccagcatcaatgacgaggtgatgaatcggcccagcgggtcagagcag
tatttccactatcgctacggctggtccttcgccttcgcagcctcctccttcctcctcaaa
gagggtgccggcgtgatgtccgtgtacctgttcaccaagcgctacgcggaggaggagatg
taccgcccccacccagccttctaccgcccgcgcctgagcgactgctccgactactcgggc
cagttcctgcacccggaggtgtggcaccgcgggcgcagcccctccgacatctccagcgac
gtctccatccagatgacccagaattacccccccgctatcaagtaccccgagcacatgcac
atatccacctcgccctgctag

DBGET integrated database retrieval system