KEGG   Chelonia mydas (green sea turtle): 102932741
Entry
102932741         CDS       T02989                                 

Definition
(RefSeq) aryl hydrocarbon receptor repressor-like
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
cmy  Chelonia mydas (green sea turtle)
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cmy03000]
    102932741
Transcription factors [BR:cmy03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102932741
SSDB
Motif
Pfam: PAS PAS_3 HLH PAS_11 PAS_9 Herpes_U5
Other DBs
NCBI-GeneID: 102932741
NCBI-ProteinID: XP_007061876
Position
Un
AA seq 754 aa
MIPPGECLYAGRKRRKPIQKQRPAVGNEKSNPSKRHRDRLNAELDHLASLLPFPPDIISK
LDKLSVLRLSVSYLRVKSFFQAIQEKHFRKQVGHTIKDYVSSETAIPEGGLLLESLNGFA
LVVSSDGMIFYTSSTIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCKQLHWAMNPPQLVSG
QQLQTETGEEYILSKMFKAQECDSMPADYSSFLTRCFICRVRCLLDSTSGFLTMQFQGKL
KFLLGQKKKSSSGTILPPQLSLFCIVAPLLLPSMTELKMKSLLVKAKHKADDAATMDTNS
KAISGLCETELQGRTSYHEGAAFTNVLQNAENQIKANNGENGISLFKVLTNEDHWVWVQA
NTQVLYRTGCSEYVIASQQALKEEDVHLKVPKNITSLKGQKEALNYNCAIETLGQMKHLN
WTTVKNEQDSIKVKFEPNTNDKCFMQEESLNSNTLLLGVQNNCNTNNIWTLKNSSSSCSV
NQRMNTCPSRKVGPFCNRDQSLLNLASTCPSHWGTTENCQSYSGLQQFTVENYTTDPVKL
QRPLMYPEALYDTVFPLDIPIKTEYDSDSENVADSYMMSQSRVWLDENGMVKKQLIGYPN
MVHLKTESDLSEQLSPCQKPTHCVYTPHNWQCIVTNHTNNMNINRPCKGLHNKEMTQVCP
QNSACLESIHDFQPTDFYNQFYNPNSVEEKEQNNQIFKMQCEFKNPCLVHTIKREPLDSP
PLSDNGQDGIEMIFPENALPGPVSHKTTECTFLQ
NT seq 2265 nt   +upstreamnt  +downstreamnt
atgattccaccaggggaatgtctatatgctgggaggaaaaggaggaaacccattcagaaa
caaaggcctgccgttgggaatgaaaagtctaatccttctaagagacatagggaccgtctg
aatgctgaattagatcatctggccagcctcctgccttttccaccggacataatatccaag
ttggacaaactttctgtcttgcgccttagtgtcagctatctccgggtcaaaagcttcttt
caagccattcaagaaaagcactttaggaagcaagttggtcacacaataaaagactacgta
tccagtgagactgccataccagaaggtggacttctactagaatcactgaatggctttgcc
ttggtggtgagttcagatggaatgatattttatacatcatcaactattgtggactatcta
ggctttcatcagactgatgtaatgcaccaaaatatatacgattacattcatgtggatgat
cgccaagatttctgtaaacaactgcactgggccatgaatcctccacaactggtatctgga
caacaactgcagacagaaacaggagaagaatacattctcagtaagatgtttaaggcacaa
gagtgtgacagcatgccagcagattattcttcctttttaactcgttgtttcatctgtcga
gtccgctgcctgttggacagtacttccggtttccttacaatgcagtttcaaggtaaactg
aagtttctcttgggacaaaagaagaagtcctcttcaggaacaatattaccccctcagttg
tccttattctgcatagtggcaccacttctgctcccttctatgacagagctgaagatgaaa
agtctgcttgtgaaagcaaaacacaaagctgatgatgcagccacaatggatacaaattca
aaagctatttcaggtctatgtgaaacagaattacaaggaagaacaagttaccatgaaggt
gcagctttcactaatgtgttacaaaatgctgaaaaccagatcaaagcaaacaatggagaa
aatggcatttctctattcaaagtactaacaaatgaagatcactgggtctgggtacaagct
aatactcaagttctgtacaggactggctgttcagaatacgtcattgcctcacagcaagct
ctaaaggaagaagatgtgcacctgaaggtaccaaagaacatcacaagtttgaaaggacag
aaggaagcacttaactataactgtgccattgaaactttgggacagatgaagcatcttaac
tggacaactgtaaaaaatgaacaggatagcataaaagtgaagtttgaacctaatacaaat
gacaaatgtttcatgcaagaggaatctctcaattctaacacattacttttaggtgttcaa
aacaactgcaacacaaacaacatttggactttaaaaaattcatcaagttcttgttctgta
aatcaacgcatgaatacatgtccgagcagaaaagttggaccattctgtaacagagatcaa
agtcttttaaatttagcatcaacctgtccttcccactggggtactacagaaaattgccag
tcttattcaggcttacagcaatttacagtggagaactacactacagatcctgtgaaatta
caacgtccactgatgtacccagaagctctatatgacacagtatttcctctagatattccc
atcaaaactgaatatgattctgattctgaaaatgtagctgatagctacatgatgtcacaa
agtcgagtctggctggatgagaatggtatggtgaaaaagcagctgattggctaccctaac
atggtgcaccttaaaacagaatcagacctcagtgagcaactgtctccttgtcaaaaacca
acgcactgtgtttacacaccgcacaattggcaatgcattgtaacaaatcataccaacaat
atgaatataaacagaccatgtaaagggttacataacaaagagatgacacaggtttgcccc
cagaactctgcatgtttggaaagcatccatgactttcagcctacagacttctacaatcag
ttctataaccccaattcagtagaagagaaagagcagaataaccagatttttaagatgcaa
tgtgagtttaaaaatccctgcttggttcacacaatcaagcgtgaacccttggattctcca
ccattgtctgataatgggcaggatggaatagagatgatcttccctgaaaatgcattacca
ggtcctgtgtctcataaaacaaccgaatgtacatttttacaatag

DBGET integrated database retrieval system