KEGG   Chelonia mydas (green sea turtle): 102933310Help
Entry
102933310         CDS       T02989                                 

Gene name
ITPK1
Definition
(RefSeq) inositol-tetrakisphosphate 1-kinase
  KO
K00913  inositol-1,3,4-trisphosphate 5/6-kinase / inositol-tetrakisphosphate 1-kinase [EC:2.7.1.159 2.7.1.134]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy00562  Inositol phosphate metabolism
cmy01100  Metabolic pathways
cmy04070  Phosphatidylinositol signaling system
Module
cmy_M00132  Inositol phosphate metabolism, Ins(1,3,4)P3 => phytate
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102933310 (ITPK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    102933310 (ITPK1)
Enzymes [BR:cmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.134  inositol-tetrakisphosphate 1-kinase
     102933310 (ITPK1)
    2.7.1.159  inositol-1,3,4-trisphosphate 5/6-kinase
     102933310 (ITPK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ins134_P3_kin Ins134_P3_kin_N RimK
Motif
Other DBs
NCBI-GeneID: 102933310
NCBI-ProteinID: XP_007055521
Position
Un
AA seq 395 aa AA seqDB search
MEHREQKKERVQDCTPLTGVSFLYDFLQLDLTKPIEDQGPLDVIIHKLTDVILEADQNDS
QSLELVYRFQEYIDAHPETIILDPLPAIRTLLDRSKSYELIRRIEAYMQDERICSPPFME
LTSACGEDTLQVIEKNGLAFPFICKTRVAHGTNSHEMAIIFNQEGLKAIQPPCVIQSFIN
HNAVLYKVFVVGESYTVVKRPSLKNFSAGISDRESIFFNSHNVSKPESSSVLTALDKIEG
VFERPNDDVIREISKALRQALGVSLFGIDIIINNQTGQHAVIDINAFPGYEGVAEFFTDL
LNHIAAVLQGQTPEVTQLNLSKLLAEQTGGIVGERTCCASTGCRSVVGKDSSWIVESETN
SSVKLQHQRLGCNSAVSPSFQQHCVATLATKASSQ
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggagcaccgggaacagaaaaaggaaagagtgcaggattgcaccccgctgacaggagtt
tcttttttgtatgacttcctccagctcgaccttaccaaaccgattgaagatcagggcccg
ttggatgtgatcatacataaactgacagatgtcatccttgaagcagaccaaaatgacagc
cagtcgttggagttggtttacagattccaggagtatattgatgctcaccctgaaaccatc
atcctggacccccttcctgctatccgtacgctgctggaccgatccaagtcttatgagctt
attcggcgaatagaggcctacatgcaagatgagaggatctgttcaccaccctttatggag
ctgacaagcgcctgtggagaagacaccttgcaggtcatagagaagaatggactagcattc
ccattcatttgtaaaaccagagtggcccatggaaccaactctcatgagatggcaatcata
ttcaaccaggaaggcctgaaggccatccagcccccctgcgtgattcagagcttcatcaat
cacaacgctgtgctgtataaagtgtttgtggtcggggagtcctacactgtggtaaaaaga
ccatctttaaagaacttctcggcaggcatttcagatagagaatcaatatttttcaacagc
cacaatgtgtcgaagccagaatcctcctctgtcttaacagcacttgataaaatcgaaggt
gtgtttgaacggccaaatgatgacgtcatccgggagatctccaaggcactgagacaggct
ctgggggtttccctctttgggattgatattatcattaacaatcagaccggccagcatgca
gtcattgatatcaatgcattcccaggttatgagggtgttgcagagttcttcacagacctt
ctgaaccacatagctgctgtcctgcagggccagacaccagaggtgacccagctaaacctc
agcaaactcctggctgagcagaccggcggcatagtaggggagcggacatgctgtgctagt
acaggctgccgaagcgtggtgggaaaagactcctcctggattgtggaaagtgagaccaat
agctcagtaaagctgcagcaccagagactaggctgcaactctgcagtgtcccccagcttt
caacagcactgcgttgccacgttggcaacaaaagcttcctctcaatag

DBGET integrated database retrieval system