KEGG   Chelonia mydas (green sea turtle): 102933631Help
Entry
102933631         CDS       T02989                                 

Gene name
BST1
Definition
(RefSeq) bone marrow stromal cell antigen 1
  KO
K18152  ADP-ribosyl cyclase 2 [EC:3.2.2.6 2.4.99.20]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy00760  Nicotinate and nicotinamide metabolism
cmy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    102933631 (BST1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cmy04090]
    102933631 (BST1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cmy00537]
    102933631 (BST1)
Enzymes [BR:cmy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     102933631 (BST1)
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     102933631 (BST1)
CD molecules [BR:cmy04090]
 Proteins
  102933631 (BST1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cmy00537]
 Enzymes
  102933631 (BST1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rib_hydrolayse Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 102933631
NCBI-ProteinID: XP_007055444
Position
Un
AA seq 282 aa AA seqDB search
MMNSFFLSLLVGLLFSKDYVKPTEIDGKKKWKGEGTTPNLESIVIGRCYEYIRIVNPSVG
EKNCTKIWEAFKKAFMNKDPCNILPSDYELFINLSRHTIPPNKSLFWENNHLLVTSYSDR
TRRYMPLCDTLIGSFGDFLNWCGQANDTGFNYDSCPTIEECENNAVETFWKIASITYAKQ
SSGVIYVMLNGSAIGGAYPVKGFFADYEVPNFQKDRISRIEIWVMDDIGGPDLDSCGRGS
VQILEERLKTMGYDITCIDNYKSVLLLKCLDYLNHPDCSIVS
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacagcttcttcttgtctctgttagtaggtcttcttttcagtaaagactatgtt
aaacccacagaaatagatgggaagaagaaatggaaaggtgaaggtaccacacctaacctg
gagagcattgtaattggaagatgttatgaatatattagaattgtgaatccaagtgttggt
gagaagaactgtacaaagatatgggaagctttcaaaaaggctttcatgaataaggatcct
tgcaacattttaccatcggactatgagttatttattaacctgtctcggcatacaattcca
cctaacaagtctcttttctgggaaaataaccatctgctggtcactagctattctgataga
actcgtcgctacatgcctctttgtgatactttaattggttcatttggagatttcctgaac
tggtgtggacaagcaaacgatactggatttaattatgattcctgccctaccatagaagag
tgtgaaaataatgcagtagaaacgttctggaagattgcatcaatcacttatgcaaagcag
agctcgggggtaatatacgttatgctgaatggttctgcgatagggggcgcctatccagtc
aaaggtttttttgcagactatgaagtgcctaacttccaaaaagacagaatttcacgaatt
gaaatctgggtcatggatgacattgggggacctgacttggattcctgtgggagaggcagt
gtacaaatattagaagagagactcaaaaccatgggttatgacatcacctgcattgacaat
tacaaatctgtactgctgttaaagtgcctggattatcttaatcaccctgattgttccatt
gtttcgtaa

DBGET integrated database retrieval system