KEGG   Chelonia mydas (green sea turtle): 102936731Help
Entry
102936731         CDS       T02989                                 

Definition
(RefSeq) threonine synthase-like 2-like
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
cmy  Chelonia mydas (green sea turtle)
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102936731
Enzymes [BR:cmy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     102936731
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 102936731
NCBI-ProteinID: XP_007063781
Position
Un
AA seq 478 aa AA seqDB search
MRYVSTRGEVRSVDFEGALFSGYALDGGLFVPQEIPTLDYNTLRTWSAFPYPELVKELSS
LFISSELIPRKELNDLTYSAFRRFRHNHVVHLARLKDGLNVLELWHGVTYAFKDLSLSCT
GQFLQYFLKKRKQHITILVGTAGDTGSSAIESVRGENNMDIFVLLPKGLCSQLQELQMTT
VIEENVHVFIADGNSDEIDEPIKELVADADFARQHNLMSLNSINWSRIMVQIAHYFYAYF
QCTPSMDMTPLPAVEIVVPTGGGGNITAEYIAQKMGLPIRLVAVVNKNNDSMHRAIQHGD
FSFSGSVKPTLASAMDIQEPYNMERILWLLSDCDGSLIKTLMEQFYTSKHLTLSEEVQRK
LSEALSSCSASDEDIVQAMRRCWEDNHYLLCPHSAVAVHYHYQQLDCHVSNRPRCCLAPA
SAAKFPDAVLRVKLVPEVPPDIQALKAMETRSTTLRREDDWAKTLRDRIEAIAMRRHT
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaggtacgtcagcactcgaggagaagtcaggagcgttgactttgaaggagccctcttt
tctggctatgcactggatggtggcctttttgtgccccaggaaatccctaccctggactat
aacactctgcgaacatggagtgccttcccctacccagagctggtgaaagagctgagttca
ctcttcatctcatctgaactaatcccacggaaagagctgaatgatctgacttacagtgcc
ttccggaggttccggcacaaccacgttgtgcatctggccaggctgaaggatgggttgaat
gttttggagctctggcatggtgtaacttatgcctttaaggacttgtccttgtcctgcaca
gggcagtttttacagtacttcctgaagaaaaggaagcagcacatcactattctagttgga
actgcgggagacaccggtagctcggcaattgaaagtgtgcgaggggaaaacaacatggat
atctttgttctattacccaaaggtctctgcagccagctacaagaactgcagatgacaaca
gtgattgaagagaacgtccatgtctttattgctgatggaaatagcgatgaaattgacgag
ccgatcaaagaattggtcgctgatgcagattttgccagacaacacaatctgatgagtttg
aactcaatcaactggtctaggattatggtgcagatcgctcactacttctatgcttacttt
cagtgcaccccatccatggacatgactccactgccggctgtggaaattgttgtgccaaca
gggggtggaggaaatatcacagctgaatatatcgcccagaaaatgggacttccaatccga
cttgtcgctgtggtgaataaaaataacgacagtatgcacagggcaattcagcatggagat
ttctcgttctcggggagcgttaagccaactttagcttctgcaatggatattcaggaacct
tacaatatggagagaatcttgtggctgctttcggactgtgatggcagcttgattaaaact
ctgatggaacagttttacacgtcgaaacaccttacactctcagaagaagtgcagagaaag
ctttctgaagcgctgagctcatgttcagcatctgacgaagacattgttcaagcaatgaga
cgctgttgggaagataatcactacctgttgtgtccccactcagctgtggctgttcactac
cattatcagcagttggactgccatgtcagcaacagacccaggtgctgcttagcacctgcc
tcagcagcaaagttcccagatgccgtgctccgagtgaagcttgttcctgaagttccaccc
gatatacaagctttaaaagcgatggagaccaggtccacgacactgaggagagaagatgac
tgggcaaaaaccctaagagacagaatagaagccatcgccatgcgcagacacacatag

DBGET integrated database retrieval system