KEGG   Chelonia mydas (green sea turtle): 102937118
Entry
102937118         CDS       T02989                                 

Gene name
ADAMTS13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
cmy  Chelonia mydas (green sea turtle)
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cmy01002]
    102937118 (ADAMTS13)
Enzymes [BR:cmy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     102937118 (ADAMTS13)
Peptidases and inhibitors [BR:cmy01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   102937118 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin ADAM_spacer1 Reprolysin_4 TSP1_spondin Reprolysin_3 Reprolysin_5 TSP1_CCN Reprolysin_2 Peptidase_M10
Other DBs
NCBI-GeneID: 102937118
NCBI-ProteinID: XP_007061081
Position
16
AA seq 1392 aa
MHLELLVVVGPDVYQFHTEDTERYILTNLNIGAELLRDASLGAQLRVHLMRMMVLTEPEV
GMNITMNITSSLVSVCEWSKKVNPQNDSDPQHADLVLYVTRFDLELPDGNKQLRGVTQLG
GACSSSWSCVITEDTGFDLGVTIAHEIGHSFGIHHDGEGNRCSGSGNIMGSEGSHNSVDL
VWSECSREQFLAFLRTGQASCLNDLPDLEGSIPGWKPGLYYGADEQCKIAFGSAATACTF
ARNDIDMCRVLSCHTHRADQTSCTRLLVPLLDGTECGINKWCSKGRCSSLEELNPGAAVH
GQWSSWSPLTACSRSCGGGVITRRRLCNNPRPAFGGQECRGADLQAEMCNTQACLSSQLE
FMAEQCAATNVKPLYLIPEVPSFYKWTSAIGYAKGDTLCKHMCKAEEKNFMVSRGVSFTD
GTRCEQSNRRAKGAFDLCVMGSCRVFGCDGRMDSGMVTDSCKVCGGDNATCTRVSGSYTE
GKAKEYVTFLALPHKATLVYVTNRKPLFTHLAVKVQGRYVVAGKERISLNITYPSVIEDS
QIKYRVLLTEDNLPSLEEVHVDGPTQEDIEIQVYRKYGKEYGDVTNPDITFRYFIPKEKQ
THVWIPQFRTCSVSCGEGVLQVNHSCFDQTRNEITDDQQCSETPQPPSRQEPCAMAPCPG
SWVAGDFGPCSATCGGGAMERLVRCMKREGGLILTLPDSKCMDAPKPASTEACSTEPCPI
RWKESEPGKCSAICGAGVTQQNVTCVQILDGLETTVDDSLCLAEEKPLAFVPCVVNICPL
GWNTDNSPSREELVPFGSLQKENRLVHVWSPLLGECTVTCGGGVAQLRYVCVAFETKEET
QEKHCNQVQKPASRLESCNPMLCPPSWEVKELAACPVSCGGGRIPLSLRCVRQEGNRTRP
LPHSKCGRMPRPARTKECGTDLCPARWHYKMDSCSVSCGGGVVRRVLYCARETGDKVEEI
VSDAQCHGLPRPEEQELCNLEPCPPRWKVAATGSCSSSCGLGIATQLITCVQLRQGLETE
LEESLCPEAERPLSSIPCIIRMCSYEWGFSEWTECSASCGNGIQMRQDFCLNPKTHEHVN
PVFCMRSPKPITVRGCSAGPCPEQPVVDGSSVSEHQIPTSAMNPITTAATTYSERPEYKA
LDRLPTRVLAPSPKRPEELPAGEEDTAEEYSVCGRLFLNSTGVINMTGLRVSDCTVSIGR
PLGEVVTVQVLESSLNCSAGEIVLFSGRRMWWTGCKKLTVSSVNSRTNTLMVRQRLLLPG
NGVVLQYNSKAAAKKYHQDCDVQLFGPWGEIVNPGQLPDPKQQVACRTFISVAPRYRIAI
HALYMDPGTENNQTHSNYISIRDVNAMKTTVFRGKQMFFWESTGSRAEIEFHEGFTEDRV
SFRAVYWVREPR
NT seq 4179 nt   +upstreamnt  +downstreamnt
atgcacctggagctgctggtggtagtgggccctgatgtttatcagttccacacagaggac
accgagaggtacatccttaccaacctgaacatcggtgcagagctgctgagagatgcctcg
ctgggagctcagctcagggttcacctgatgagaatgatggtcctgacagaaccagaggtg
ggtatgaacatcaccatgaacatcacctcctcgctggtcagtgtctgtgagtggagcaag
aaggtcaatccccagaatgattcagatccccagcatgccgaccttgtcctgtatgtgacc
aggtttgacctggagttaccagatggaaacaagcaactgcgcggagtcacccagctgggg
ggagcctgctcctcctcctggagctgcgttatcaccgaggacactggcttcgacttggga
gtcaccatagcccacgagatcgggcacagttttggaatccatcacgacggtgaaggaaac
cggtgcagtgggagtggcaacatcatgggttccgagggcagccacaacagcgtggacctg
gtctggtcggagtgcagcagagagcagttccttgcctttctcaggacaggccaagcaagc
tgcttgaacgacctgccggacctggagggcagcatccccgggtggaagcctggcttgtat
tacggcgcagacgagcagtgtaaaatagcctttgggagcgcagccacggcgtgcaccttt
gccaggaatgacattgacatgtgcagagttctctcttgccacacccatcgggccgaccag
accagctgtactcgccttcttgttccccttctggatgggaccgagtgtgggatcaataag
tggtgctccaagggacgctgtagctctctggaagagctgaaccccggggcagcggtgcat
ggacagtggtccagctggagccccctcaccgcttgctcccgcagctgcggaggaggagtt
ataacgagaagacgactctgtaacaaccccaggcctgctttcgggggtcaggagtgcagg
ggagcagacctccaggctgagatgtgcaatacgcaggcctgtttgagctcccagttggag
tttatggctgaacagtgcgcagcgacaaatgtaaagccgctgtatctcattccagaagtc
ccatctttttataagtggacgtcggctattggttatgccaaaggggataccctgtgcaaa
cacatgtgcaaggcagaggagaagaatttcatggtgagccgcggggtcagtttcacagat
ggaaccaggtgtgagcagagcaaccgcagagccaaaggggctttcgatctgtgcgtgatg
ggcagctgcagggtgttcggctgtgacggcaggatggactctgggatggtgacagactcc
tgcaaggtgtgcgggggagacaacgccacgtgcaccagagtgagcggctcttacacagaa
ggaaaagccaaagagtatgttacgtttctagccctgcctcacaaggccaccctcgtctac
gttaccaatcgcaaacctctcttcacacatttggctgtgaaggtccaaggtcggtatgtg
gtggctgggaaggagagaatctccttgaacatcacctatccgtcagtaatagaggacagc
cagatcaaatacagggtgttacttactgaggacaacctgccaagcctggaggaagtccat
gtcgatggaccaacccaagaggacattgagattcaggtttataggaagtatgggaaggaa
tatggagatgtcaccaacccagacatcaccttcaggtactttataccaaaggagaaacag
acacatgtgtggattcctcagttcaggacctgctcggtgagctgtggggaaggggtgcta
caggtcaatcattcctgctttgatcagaccaggaatgaaataacagatgatcagcagtgc
tcggagactccacagcccccttcaaggcaggagccctgtgccatggcgccatgcccaggc
agctgggtggcaggggacttcggcccctgcagtgccacatgtgggggtggagcgatggag
cggctggttcgctgtatgaagagagaagggggcttgatcctgactcttcctgattccaaa
tgcatggatgctcccaaacctgcctccaccgaggcatgtagcactgagccgtgtcccata
agatggaaggaatctgagccgggcaaatgctctgccatctgtggggctggagtcacccag
cagaacgtgacctgtgtacagattcttgatggactggagaccacagtagacgacagcctg
tgcttggcggaagagaaacctctagcttttgtgccatgtgtggttaatatctgtcctcta
ggctggaacacagacaattcgccctcacgggaagagctggtgccatttgggagtctccag
aaggaaaatcgcttggtgcatgtctggagccctctccttggcgaatgcaccgtgacctgt
ggtggaggtgtggcccagcttcgctatgtgtgtgtggctttcgagaccaaagaagaaacc
caagagaaacattgtaatcaagtgcaaaagccagcgagcaggctggaaagctgcaatccc
atgctgtgcccaccaagctgggaggtgaaggagctggctgcatgcccagtgagctgtgga
ggagggagaataccactctctcttcgctgtgtaagacaagaaggaaatagaacccgtcct
cttcctcattccaaatgtggtaggatgcccaggccagccagaaccaaggagtgtggcact
gatctgtgcccagcaaggtggcattacaaaatggactcgtgcagcgtaagctgcggagga
ggtgtggtgcgcagggtcctgtactgtgcgagggagacaggggacaaggtggaagagatt
gtatcagacgcacagtgtcatggtttgcctcgcccagaggagcaggagctatgtaatctg
gagccgtgcccgccaagatggaaagtagcagcaactggttcgtgttcctcctcttgtggg
ctcggcatagccacgcaattgatcacctgtgtccagctccgccaaggcctagagaccgag
ctggaagagagtttgtgtccggaggcagagagacccctctccagcatcccctgtatcatc
agaatgtgctcctatgagtggggtttcagtgaatggacagagtgctcggcgtcgtgtggg
aacggcattcagatgcggcaggatttctgcctcaatccgaaaacccatgagcacgtgaac
cccgtcttctgcatgcgctcccccaagcccatcacggtgcgtggctgctctgccggcccc
tgtcctgagcagcctgtggtggatggatcctcggtatcagaacaccagataccaacttca
gctatgaacccgataacgacagcagccaccacttattccgagaggccagaatacaaagcc
ctggatcgtcttccaaccagggtgctggctccttcacccaaacgccccgaggagcttcca
gcaggggaggaggacactgctgaagagtacagtgtctgtgggaggctcttcctcaactcc
accggggtcatcaacatgactggcctgcgggtcagtgactgcacggtttccatcggacgc
cccttgggggaagtggtaacagtccaggtgctggagagctccctaaactgcagtgcaggg
gagatagtgctgttttctggacggaggatgtggtggacaggctgtaagaagctgacggtg
tcatccgtaaactccaggaccaacacattgatggtgaggcagcgcctcctgctgccaggg
aatggtgtagttcttcagtacaacagcaaagcagcagcaaaaaaatatcaccaagactgt
gatgtgcagctgtttggaccctggggtgaaatagtgaatcccggacagttgccagaccca
aaacaacaagtggcatgtcggacctttatcagtgtggctccacggtatcgcatagccatc
catgccctctacatggacccggggactgaaaacaatcaaacacactccaattacatctcg
atacgcgatgtgaatgccatgaagacaacagtgtttcgtgggaaacagatgttcttctgg
gaatcgacaggtagccgggctgaaattgaatttcatgaaggctttacagaagatcgtgtc
agtttccgagcagtgtactgggtcagagagcccagataa

DBGET integrated database retrieval system