KEGG   Chelonia mydas (green sea turtle): 102939340Help
Entry
102939340         CDS       T02989                                 

Gene name
DPP3
Definition
(RefSeq) dipeptidyl peptidase 3
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
cmy  Chelonia mydas (green sea turtle)
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cmy01002]
    102939340 (DPP3)
Enzymes [BR:cmy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     102939340 (DPP3)
Peptidases [BR:cmy01002]
 Metallo Peptidases
  Family M49: dipeptidyl-peptidase III family
   102939340 (DPP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-GeneID: 102939340
NCBI-ProteinID: XP_007056272
Position
Un
AA seq 729 aa AA seqDB search
MVDSQYVLPNDVGLALLDCSEAFRLLLRSERLYAHYLSRACWYGGLVVLLQTSPEAPAIY
VLLSRLFRAQDPDQLGELARSAGLTDLEYQAFLVYAAGVFSNMGNYKSFGDTKFVPNLPK
DKLRQLIWQSQAFQERPEEMESLWDRCGELMFSLDPHQRQLGLREKGTTTYFSGNCCLED
AQLAQKFLDSQNISAYNTRLFKEKDKAGQTCYEVRLASVLGTDAPVDHELAPKLRCFEFE
GCTFRVTRGDYAPLLEKVVENLQRTKAHAANTNQERMLEHYIRSFTQGSIAAHKEGSRSW
IRDKGPIVESYIGFIESYRDPYGSRGEFEGFVAIVNKAMSAKFARLVESAEQLLLELPWP
RAFEKDTFLTPDFTSLDVLTFAGSGIPAGINIPNYDDIRQTEGFKNVSLGNVLSVAYATQ
KDKLTFLAEEDKDLYIKWKGPSFEVQVGLHELLGHGSGKLFVQEEKGTCNFDREAVINPE
TGELIQSWYRGGETWDSKFSTIASSYEECRAECVGLYLCLNKDVLRIFELEGEDAEDVIY
INWLNMVRAGLLGLEFYTPETGTWRQAHMQARFVILRVLLEAGEGLVSLQHTTGADGKPD
ALITLNRNKILPVGKPAIERFLRRLQVRGRAGLQGARALYEGFSAVTDEGPERFLSLRDT
VLLRKEARKMFVQANTRLEGEDVTLVQYEGTAAGLIRSFSERFPEDAELLERHLLELSDG
NAHFWASQG
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atggttgactcacagtacgtgctgcccaacgatgtggggctggcgctcctggactgcagc
gaggccttccggctgctgctgcggagcgagcggctctacgcccactatctgtcacgtgcc
tgctggtacggggggctggttgtgctgctccagacctcacctgaggcaccagccatctat
gtgctgctctctcggctcttccgtgcccaggaccctgaccagctgggggaattggcacgc
tccgctggcctcactgacctggagtaccaggcgttcctggtttacgccgctggcgtcttt
tccaacatggggaactacaaatcttttggggacaccaagtttgtgcccaacttgcccaag
gacaagctccggcagctgatctggcagagccaagcattccaggagcggccagaggagatg
gagtcgctgtgggataggtgtggggagctgatgttctcgctggacccgcaccagagacag
ctggggctcagagagaagggcaccacgacctatttctccgggaactgctgtttggaggat
gcccagctagcccagaaattcctcgactcgcagaacatcagtgcctacaacacgcggctc
ttcaaggagaaggacaaggcagggcagacatgctatgaggtgcggctggcatcagtgctg
ggcactgatgcacccgtcgaccatgagctggcccccaagctgcgttgctttgagtttgag
ggctgcacgttccgcgtgacccgcggggactacgcacccctgctggagaaagtggtggag
aacctacagcgcaccaaggctcatgctgccaacacaaaccaggagcgcatgctggagcat
tacatccgtagcttcacgcagggctccattgcggcccacaaggaaggttcccgcagctgg
atccgtgacaaggggcctattgtcgaaagttacatcggctttattgaaagctatcgagac
ccctacggctcccggggggagtttgaaggatttgtggccatcgtgaacaaggccatgagc
gccaagtttgcgcggctggtggagtcagctgagcagctgctgctggagctgccctggccc
cgtgccttcgagaaggacaccttcctcacgccggacttcacctcgctggacgtgctgaca
ttcgcaggcagtgggatcccggctggcatcaacatccccaactatgacgacatccgccag
accgaaggtttcaagaatgtgtccctgggcaacgtgctgtcagtggcctatgccacccag
aaggacaaactgaccttcctcgctgaggaggacaaggacctgtacattaagtggaagggg
ccatcatttgaggtgcaggtcgggctgcacgagctgctggggcatggcagtgggaagctc
tttgtgcaggaggagaagggcacctgtaacttcgacagggaggctgtgatcaacccggag
acgggggaactgatccagagctggtaccggggcggcgagacatgggacagcaagttctcc
accatcgcgtcgagctacgaggagtgtcgggctgagtgcgtggggctctacctctgcctc
aacaaggacgtgctccggatttttgagctggaaggcgaggatgcggaagatgtgatctac
atcaactggctgaacatggtgcgggctgggctgctagggctggagttctacacccctgag
actggcacctggcgccaggctcacatgcaggcgcgctttgtgatcttgcgggtgctgctg
gaggcgggcgaggggctggtgtcgctgcaacacaccacgggcgctgacggcaaacctgat
gcactcatcactctcaaccgtaacaagatcctgcctgtggggaagccggccatcgagcgg
ttcctgcgcaggctgcaggtgaggggcagggcagggctgcagggcgcccgggcgctctat
gagggtttctcagccgtgacagacgaggggcctgagagattcctgagcctgcgggacacc
gtgctgctacgcaaggaggcacgcaagatgtttgtgcaggccaacacccgcctggaaggc
gaggatgtgaccctggtgcagtatgagggtaccgcggccggattgatccgctccttctct
gagcgattccctgaggatgctgagctcttggagcgccatctgctggagctgtcggacggc
aacgcccacttctgggcaagccagggctga

DBGET integrated database retrieval system