KEGG   Chelonia mydas (green sea turtle): 102939448
Entry
102939448         CDS       T02989                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy04080  Neuroactive ligand-receptor interaction
cmy04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102939448 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102939448 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 102939448
NCBI-ProteinID: XP_007063880
Position
Un
AA seq 80 aa
MTKLDSNSKLLKYFSIRVKCSDVADSPLAEAPDGRDLEKGNIRNLVHPKGVRNGAGHRQN
GWRKSRRPRPRLSHKGPMPF
NT seq 243 nt   +upstreamnt  +downstreamnt
atgaccaagttagactccaactccaagttgcttaaatattttagcatcagggtgaaatgt
tcagacgttgctgactcaccattggctgaggcgccggatggcagagacctggagaaaggg
aacatccggaacctggtgcaccccaagggggtgcggaatggagcaggacaccggcagaat
ggctggcgaaagtcccgacgtccaagaccccgtctctcccacaagggccccatgcctttc
tag

DBGET integrated database retrieval system