KEGG   Chelonia mydas (green sea turtle): 102939646Help
Entry
102939646         CDS       T02989                                 

Gene name
ABHD12
Definition
(RefSeq) abhydrolase domain containing 12
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
cmy  Chelonia mydas (green sea turtle)
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cmy01002]
    102939646 (ABHD12)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmy04147]
    102939646 (ABHD12)
Enzymes [BR:cmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102939646 (ABHD12)
Peptidases [BR:cmy01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   102939646 (ABHD12)
Exosome [BR:cmy04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   102939646 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Myb_DNA-bind_4 Abhydrolase_6 Abhydrolase_3 Peptidase_S9 Thioesterase Peptidase_S15 Say1_Mug180 Chlorophyllase2 Abhydrolase_2
Motif
Other DBs
NCBI-GeneID: 102939646
NCBI-ProteinID: XP_007059040
Position
Un
AA seq 364 aa AA seqDB search
MDLIAVWGEESVETELQSNRRNTAIYAKIALGMREKGYMRDGQQCSVNIKELRQAYQKFK
FLTFYSFLCVSVRVPYFIDLKRPQDQGLNHTYNYYLQPEEDVTIGVWHTVPAALWKDAQS
KGQPWYEDTLGSNHPVILYLHGNAGTRXGXXRVELYKVLSSLGYHVVTFDYRGWGDSVGT
PSERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERETPPDALILESP
FTNIREEAKSHPFSVIYRYFPGFDWFFLDTITMSGIKFANDENVKYISCSLLILHAEDDP
VVPFHLGKKLYNIAAPSRSFRDYKVQFVPFHRDLGYRHKYIYRSPELPRILREFLGKSEH
AHHH
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggatctcattgctgtgtggggagaagaatctgtggagacagagctccaatccaacaga
agaaacactgcgatctatgcgaagatcgctcttggaatgagggagaagggctacatgagg
gacggacagcagtgcagcgtgaacataaaagaacttcgccaagcgtaccagaagttcaag
tttctgaccttttactctttcctttgtgtttcagtgagggttccgtatttcattgacttg
aaaaggccacaggatcaaggcttaaaccacacctataattattaccttcagccagaggag
gatgtaaccattggagtctggcacaccgttcctgcagccttatggaaggatgctcaaagc
aaaggccagccatggtatgaggacactttgggatccaaccatcctgtaatcctttacttg
cacggaaatgcaggaactaggtaaggnnnnnnncgtgtggaactttacaaggttctaagt
tcccttggttaccatgtagtcacatttgattatcgagggtggggagattctgtgggcact
ccgtcagagagaggaatgacctatgatgcactccatgtttttgactggataaaagcaaga
agtggagacaatcctgtctatatatgggggcactccttaggcacaggagttgcaacaaat
ttagtgcgacgtctttgtgaaagagaaactcctccagatgccctaatactggaatcacca
tttactaatatacgtgaagaagcaaaaagccatccgttttcagtgatatatagatacttc
cctggatttgactggttcttccttgacaccatcacaatgagtggaattaaatttgcaaat
gatgagaatgtaaaatacatttcctgctcgctgcttattcttcatgctgaagatgatcct
gttgtaccatttcatcttggaaagaagctttataacattgctgcaccatctcggagtttc
cgtgactacaaagtacagtttgttccatttcacagagacctcggctacaggcataagtac
atatacaggagtccagagctacctcgaatactgcgggaattcctgggaaaatctgaacat
gcacatcatcactga

DBGET integrated database retrieval system