KEGG   Chelonia mydas (green sea turtle): 102939942Help
Entry
102939942         CDS       T02989                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4-like
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102939942
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cmy01001]
    102939942
Enzymes [BR:cmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102939942
Protein kinases [BR:cmy01001]
 Serine/threonine kinases: STE group
  STE20 family
   102939942
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 102939942
NCBI-ProteinID: XP_007060281
Position
Un
AA seq 1224 aa AA seqDB search
MARDYTAKSLDNIDLAALRDPAGIFELVQVVGNGTYGQVYKGRHVKTGQLAAIKVMNVTE
NEEEEIKLEINMLKKYSHHRNIATYYGAFVKQSPAGQDDQLWLVMEYCGAGSVTDLVKKT
KGNCFKEDWIAYICREVLRGLAHLHINHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TIGRRNTFIGTPYWMAPEVIACEENQDSTYDYRSDLWSLGITAIEMAEGAPPLCDMHPMR
ALFLIPRNPPPKLKSRKWSKKFLNFVESCLVKNYLHRPSTETLLKHSFIRDMQNERQVRI
MLKDHLDRTRKKKGEKDETEYEYTGSEEEDDELDEDEGEPSSIVNIPGESTLRREFLRLQ
QENKNRSDPHRQQQFQQQQLKDQEKYKKQLQAERQKRIEQEKERRKRLEDHQKREEELRK
QQECEQRWPEIKAVQRRDEKCEDDKRFVDEEMCKVDGQRKSERKQKKVEEVQHNKKLHRT
LPKDQTQLLSLQHDHKQKKKELPKSSSSASQPPPSSTSKEAEDRKKKNDGIQTHLSWAAV
LGHEATPHTRLGSGSSSSPCTPALQRAVLAQSENLRTSRDVYHSSSLSDMVITPLSPGQD
DVFWSVCQNEEQPPKVPERTTSKFYSKDHLGRQRCPSRRPMRVLRDCPVVVCAMCLMLLS
TTLLLGNQGSSKAESPLSQNHPQQCKKSENAPHPAQFSSPAFFAKGKDGANMFSTVAEYS
SSSDELLSSDDDDTIHTRQLLSNGMADFSRTRVPDGIELKPQSIVIEQKNHIAEKQSCST
QEGLWSIHNQNYLLPDLLQQSQISDSSANQQKVTQNSQGPQNKSTSSAESTPSKGSSSST
TSFTSFIDPRLLQISPPSSPAGPTCSSPSSPKPEPIRRGNARKGSVVNVNPTNIRPQSDS
PEIRKYKKKFNSEILCAALWGVNLLVGTENGLWLLDRSGQGRVYSLITRRRFQQMDVLEG
LNVLITISGKKNKLRVYYLSWLRNKILRNDPEVEKRQGWVSVGDLEGCVHYKVVKYERIK
FLVIALKSSVEVYAWAPKPYHKFMAFKSFTSLHHKPLSVDLTVENGQRLKVIYGSQVGFH
AIDVDSGSVYDLYLPTHIQGTIHPHAIIILPNTNGTELLLTYEDEGVYLDIYGHFTKETV
LQWGEMPASVAYLQSNQVMGWGEKAIELRSVETGNLEGVFMHKKAQKLKFLCERNDKVFF
ASVQSGGSSQIYFMTLGQNVLFNW
NT seq 3675 nt NT seq  +upstreamnt  +downstreamnt
atggccagggactacaccgctaagagcctggacaacatcgacctggctgcgctccgggac
ccagcagggatatttgaactggtgcaagtagttggaaatgggacatatggacaagtctat
aagggccgccacgttaagacaggacaactagccgcaatcaaggttatgaatgttactgag
aacgaggaagaagaaatcaaactggaaataaatatgttaaagaaatattctcatcaccgg
aatattgcgacatattatggagcatttgtaaagcagagtcctgcaggccaggatgatcag
ctctggttggtgatggaatattgtggagctggctctgtaacagatttggtaaagaagaca
aaaggtaactgtttcaaggaggactggattgcgtatatctgcagagaggttctcaggggt
ttggcacatcttcatattaatcacgttatccaccgagatattaaaggacagaacgttctc
ttaacagaaaatgcagaagtaaaactagtggattttggggtaagcgctcaactggatagg
acgattgggagaagaaatacattcatcggaactccctattggatggcgcccgaggtcata
gcttgcgaggagaaccaagactcaacatatgattacagaagtgacttgtggtctctggga
atcacagctatagaaatggcagaaggagctcctcccctgtgtgatatgcatcccatgaga
gctctctttctcattccacgaaaccctcccccaaaactgaaatccagaaaatggtccaag
aaatttcttaattttgttgaaagttgcctagttaaaaattacttgcatcgtccatccact
gaaactttgcttaagcattcctttatccgagacatgcagaatgaacggcaagttcgcatc
atgctgaaagaccacctggacaggaccaggaagaaaaagggagagaaagacgaaacagag
tatgagtatactggaagtgaggaagaagatgatgaactggatgaagatgaaggagaacca
agttccatagttaatatccctggtgaatcaacgctccgtcgtgaatttctgaggctgcag
caggagaacaaaaatcggtctgaccctcatcgacagcagcagttccagcagcagcagcta
aaggaccaggagaaatacaaaaagcagctgcaggcagagcggcagaaacgaatcgagcaa
gaaaaagagcggaggaagaggctggaggatcatcagaagagagaagaagagctccggaag
cagcaagaatgtgagcagagatggccagaaattaaggcagttcagcgcagagatgaaaag
tgtgaagatgacaagagatttgttgatgaggaaatgtgcaaagtggacggacagaggaaa
tcagaaaggaagcagaaaaaggtggaagaagtgcaacacaataagaagttacatcggact
cttcccaaagatcagacccaactgctgtctcttcagcacgaccacaagcaaaagaagaaa
gagcttccaaagagctcgagttcagcatcacagcctccgccaagcagtacaagcaaagag
gccgaggacagaaagaagaaaaatgatgggatacagactcatctcagctgggcagcagtt
cttggacacgaagccacgccacatacgagactaggttctggcagtagttccagtccttgc
accccagctttgcaaagagcggtgctagcacagagtgaaaacctccggaccagtagagac
gtataccacagcagttcactgtcagacatggtgataacaccactgagcccaggacaggat
gatgtattctggagtgtttgtcaaaatgaagagcagcctccaaaggttccagaaagaaca
acctctaaattttacagcaaggatcatcttggccgtcaaagatgtccttcaaggaggcct
atgcgcgtgttgcgggattgtcctgttgttgtatgtgccatgtgtttaatgcttctctct
acaactctccttttggggaatcaaggctcgtccaaggcagagagcccactgtcccagaac
cacccgcagcagtgcaagaagtctgaaaatgctcctcacccggcccagttttcaagtcca
gccttcttcgccaaagggaaagacggtgccaacatgttctccacagtagcagaatattca
tcatccagtgatgaactgctcagcagcgatgatgatgatacgattcacacaaggcaactg
ctaagtaatggaatggcagatttctcaaggacaagagttccagatggaattgaactcaaa
ccccaaagcatcgtaatagaacagaagaatcatattgcagagaaacaaagttgtagcacc
caggaaggactctggagcatacacaaccagaactatctcctgccggatctcctacagcaa
agccaaatttcagactcctcggcgaaccagcaaaaagttacccagaatagtcaaggacct
cagaacaaatctacatcaagtgctgaaagtacaccctcaaagggcagttcatcatctaca
acatcctttacttcgttcatagatcctagactactacaaatctcacctcccagcagtcca
gcagggcctacttgtagttctccatctagccccaaaccagagcctattagaagagggaat
gcaaggaaaggctctgttgtcaatgtcaaccccacaaatatccggccacagagtgacagt
ccagaaattcgcaaatacaagaagaaatttaattcagagatcctgtgtgctgctctgtgg
ggagtaaatttactggtggggacggagaatgggttatggctgctggaccgaagtggacaa
ggaagggtttactcactgatcacaaggagacgattccagcaaatggatgttctggaagga
ctcaatgtgctaatcaccatatcaggcaaaaagaataagctgagggtgtattatttatcc
tggctgagaaacaagattctgcgcaatgatccagaggtggagaagcggcaaggctgggtg
tccgtgggagacctggaaggctgcgtgcactacaaagtcgtgaaatatgagagaatcaaa
tttcttgttattgcgttgaaaagctccgtggaggtgtacgcttgggctccaaagccctat
cacaaatttatggcttttaagtcattcacttcacttcatcacaaaccactgtcagttgac
ctgacagttgaaaatggacaaagattaaaagtgatctatggctcgcaagtgggatttcac
gctatcgatgtggactctgggtctgtgtatgacctgtacttgccaactcatatccagggg
actattcacccacatgccattattatcctccctaataccaatggaacagaacttctactc
acctatgaagatgaaggagtctaccttgatatatatgggcacttcacaaaggaaactgtt
ttacagtggggagaaatgccagcatctgtagcttatctgcagtctaaccaggtcatgggt
tggggagagaaggctatcgaactgcgttccgtggaaacaggaaatttggaaggtgtattt
atgcacaagaaagcacagaagctaaaatttctatgtgaaagaaatgacaaggtattcttt
gcatctgtacaatctggaggcagcagtcaaatttactttatgacacttggacaaaacgtc
ctattcaactggtaa

DBGET integrated database retrieval system