KEGG   Chelonia mydas (green sea turtle): 102940258
Entry
102940258         CDS       T02989                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
cmy  Chelonia mydas (green sea turtle)
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cmy03021]
    102940258 (AFF3)
Transcription machinery [BR:cmy03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     102940258 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 102940258
NCBI-ProteinID: XP_007069031
Position
Un
AA seq 1161 aa
MKDLLTDRSNQSHLVGVPKPGIPQAPVNKTDEHFIADSRPQPQPSICSTSSSIPAALSGQ
QSKSPTMGWQKAGQNASDGQQRASKHGHRLLESHSSDFKMANQKTGLEKLKHFASSPTSS
SVSAAQQGTLRSVLGDSVSKAQQQSKLNCSVEVGSQAQERPAKHSSGHCVQNFPPSLASK
ANIVQQKPTAYVRPMDGQDQAPDDSPKLKLSAEANKHCTSYRGVPSNKPDPAMAKTKMAI
FCTPKQEEESGTGDNSCIEEILREMTHSWPPPLSAIHTPGKVEQSKFPFPNKESQQVSTG
HSNPRKGDAEPKNPENSASHTSMLEDDLKLSSDEEENDQQAAQRSALRILSDSTVVPQPS
SRTSGVSSKRSSSSSSSESESSSESDSESESSSSESDGSKPSHYSSPEPEQPSSNKWQLD
KWLNKVNPHKTSILNQNDNHGLESNQYYSRIKEEGQECEKIPAICQTDLRDKEIKNPSKE
ELRPRTANKAPGNKGGKQKSPPTAAAVSGDSGPQRRTTCKKQPRRTERTSGGDALNCHTS
EDLALSQVFLENNICEQPKARPCNNRTGHRKEPRSVAACEKRRTRGPSKTAPKSKEFIET
ESSSSSSSSDSDSESEQEEYHLPKPQTVASASGGSDQRLKDSLSGNTNKTNSSCNAFGSI
NARTSNDIAKELEEQFYTLVPFGRNELLSPLKDNDEVKSLWVKIDLTLLSRIPEHLPEEP
LAMSTGAKEEASLQQNNCTYPPSEKVVPKSRRKRKCENEEEDREIKKTHLERECSSRLIA
SALGISTANHCNRNEHSLAIPINKNEKMLRSPISPLSDASKHKYSNDDLTSSSRPNGSSL
LPSMSSSKKHKSEIQPQPHPADCNKAVHINSESVLCNKPHSQTEPWPSLSRAHKDCRTKL
IFDDIPRNADHFMQEAKRKKHKADAMVEKFGKALNYAEAALSFIECGNAMEQGPMESKSP
YTMYSETVELIRYAVRLKTHAGPNATPEDKQLAALCYRCLALLYWRMFRLKRDHAVKYSK
ALIDYFKNSSKAAQAPSPWGASGKSTGTPSPMSPSPSPVSSVGSQGSTGAPSPSSTISIP
QRIHQMAANHVSVTNSILHSYDYWEMADNLAKENREFFNELDALMGPVTLHSSMEHLVQY
TQQGLHWVRNSAQAKDCVPFK
NT seq 3486 nt   +upstreamnt  +downstreamnt
atgaaggacttattgacagatcgatccaaccagagtcatcttgttggagttccaaaacct
gggattccacaggcacctgtgaacaaaactgatgaacatttcattgcagattcaagacca
cagcctcagccttccatctgcagcacttcatcatccataccagcagctctatctggtcag
caaagcaagagccccacaatgggttggcagaaagctgggcaaaatgcttctgatggccag
cagagggcaagcaagcatgggcacagattgcttgagtcacacagtagtgacttcaaaatg
gctaaccaaaaaactggtctggaaaagcttaaacactttgcatcgagtcccacatcgtca
tctgtcagtgcagcacaacaaggtactttaagatccgtgcttggagacagtgtcagcaaa
gcacaacagcagtcaaaactaaattgcagtgtagaagtaggctctcaggctcaagaaagg
ccagcaaaacacagcagtgggcactgtgttcagaacttccctccttcacttgcttcaaag
gctaatatagttcaacagaaaccaacggcttatgtaagaccaatggatggtcaagatcag
gctcctgatgattctccaaagctaaagttatcagcagaagctaacaagcactgtacatca
tataggggagtaccttctaataagcctgacccagctatggccaagaccaagatggcaata
ttttgcactcccaagcaagaagaggagagtggaacaggagataacagctgtattgaagaa
attttgcgggagatgacccattcctggcctccaccactctcagctattcacacacctgga
aaagtggaacagagcaagtttccatttccaaacaaggagtcgcagcaggtgtctacagga
cacagcaatccaaggaaaggtgatgctgaaccaaagaatccagaaaacagtgcatcacat
acatcaatgctagaagatgacctcaagttaagtagtgatgaagaagagaatgaccagcag
gcagcacagagatctgctctccgcattctgtctgacagcactgtcgtgccgcagcccagt
agcagaacctcaggagtctccagcaagaggtcaagtagcagcagctccagtgaatccgag
agcagttcagaatctgactcagagagtgaaagcagttcgagtgagagtgacggcagcaag
ccctctcattactccagcccagagcctgagcagccatcatcaaacaaatggcagttggat
aaatggctaaataaagttaatcctcacaaaacatctattcttaaccaaaatgataaccat
ggactggagagcaatcagtattacagcagaataaaggaggaaggacaagagtgtgagaaa
ataccagctatttgccaaactgacctcagagacaaggaaattaagaaccccagcaaagag
gagttgaggcctagaactgctaataaagcaccaggaaataaaggagggaagcagaaatca
cctcctacggctgctgctgtttctggagacagcggccctcagagaaggacgacttgtaaa
aaacagccaagaagaacagagaggacctctggtggggatgccttgaactgccatacatct
gaggatctcgctttgagccaagtatttttggaaaataacatctgtgaacaacctaaagcc
agaccctgcaacaacagaactgggcacagaaaagagccccgttctgtcgctgcatgtgaa
aagagacgtaccagagggccaagcaaaactgcacccaaatccaaggaatttatcgagaca
gagtcttcgtcttcatcatcttcctcagattcagattcagaatccgaacaagaggaatat
catctgcccaaacctcaaactgtggcctctgcttcaggtggaagtgaccagaggttgaag
gactccttgagcggtaacaccaacaaaactaacagcagctgcaatgcctttggctccatt
aatgccaggactagtaatgatatagcaaaggagctggaggaacagttttatactctagtt
ccttttggcaggaatgagctcctgtctcctctgaaagacaatgatgaggtaaaatcactg
tgggtcaaaattgatttgactcttctgtccagaattccagagcatttacctgaggagcca
ctggcaatgagcactggagcaaaagaagaagccagccttcagcagaataattgtacttac
ccaccatcagaaaaggttgtgccaaaatctagaaggaaacgcaagtgtgaaaatgaagaa
gaggacagggagatcaagaagactcatttagagcgagagtgttcttcacgattaattgcc
tctgccctaggtatttcaacagcaaatcattgcaacaggaatgaacatagcttggcgata
ccaataaataaaaatgagaaaatgcttcggtctcccatctcacccctctctgatgcatca
aaacacaaatactccaatgatgatttaacttcttccagtagacctaatggcagcagccta
ttaccttccatgtcctccagcaaaaaacataagagtgaaatccagccacagccacatcct
gcagactgcaataaagcagttcacatcaattcagaaagtgttctctgcaacaagccacac
tcccaaacagagccttggccatctttatccagggcacataaagactgcagaacaaagctc
atctttgatgatataccacgcaatgcagatcactttatgcaagaagctaaacggaagaag
cataaagcagatgcaatggtggagaaatttggaaaggcactgaattacgctgaagcagca
ttatcgtttattgaatgtggaaatgctatggaacaaggccccatggaatctaaatcccct
tatacaatgtattcagaaacagttgaacttatcaggtatgctgtgagactaaaaacccac
gcaggccctaatgccactccagaggacaaacagctagcagcattatgttatcgctgtttg
gcacttctgtactggagaatgttccgactcaaaagggaccacgctgtaaagtattcaaaa
gcacttattgattatttcaagaattcatcaaaagctgcccaggctccatctccatggggt
gccagtggaaagagcacaggaactccatcccccatgtctcctagcccttctcccgtcagc
tctgtaggatcccaggggagcaccggtgccccttccccctcttccactatcagcattcca
caacgtattcatcagatggcagccaatcacgtcagtgtcaccaacagcatcctgcacagc
tatgactactgggagatggctgacaatctagccaaggaaaatagagagttttttaatgag
ttggatgcattgatgggacctgtcaccctacacagcagtatggagcatttagttcagtac
actcaacaaggacttcactgggtacggaatagtgctcaggcaaaagactgtgtgccattc
aaatga

DBGET integrated database retrieval system