KEGG   Chelonia mydas (green sea turtle): 102940846Help
Entry
102940846         CDS       T02989                                 

Gene name
TMPRSS15
Definition
(RefSeq) transmembrane protease, serine 15
  KO
K01316  enterokinase [EC:3.4.21.9]
Organism
cmy  Chelonia mydas (green sea turtle)
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cmy01002]
    102940846 (TMPRSS15)
Enzymes [BR:cmy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.9  enteropeptidase
     102940846 (TMPRSS15)
Peptidases and inhibitors [BR:cmy01002]
 Serine peptidases
  Family S1: chymotrypsin family
   102940846 (TMPRSS15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin CUB MAM SEA Ldl_recept_a SRCR_2 DUF1986 SRCR XFP_C
Motif
Other DBs
NCBI-GeneID: 102940846
NCBI-ProteinID: XP_007066726
Position
Un
AA seq 1070 aa AA seqDB search
MEPSQITVAVVTALNTMRIIQQYMQNQNKNLQKQLEMNLKKLLPKRSIPLSDFEICLVVL
LTIFVCVCAGLIALVWVLSKESQQVYGNSHAATGTFKILSGASFSPGLQDNSSADFKALA
SDVQQLINEIYQASQLKNEYKNSEVLQFKNGSIIVIFNLYFAQRVSNEKAKNELVLGTQA
NKTSLLQTIKIDVNSIEITGNYENYSTSPPLTSSEPLTTSKSSATKGEIQLTCLPPEEPC
ADAINCISKDLFCDGVPNCPDGSDESEKICATTCDGTFMLTGSSGSFHSINYPKPYNSNI
VCQWIIRTNQGLSIKLNFTSFDTQQYADILNIYEGTGPSKILRASLWGTNPGTIYIFSDE
ATAEFVTDYSENYNGFNATYTIFSTSELSNNEKINCNFEDGFCYWIQSLEDDSEWERISG
PTFPFMSGPDYDHTYGNLSGFYISTPTGFTARQERVRLFSLPLVPASDQFCLSFWYHMYG
TNVYRLSINIMNSSNMEKTVFQKEGNYGNNWNYGQVTLNETSDFKVIIDAFKKQGQSDIA
LDDIGLISGQCKESIYPEPTLVPTSTTPPSLPTDCGGPFELWEPNTTFSSTNFPNNYPHQ
ASCVWYLNAGKGKNIQLHFQYFELENIYDVVEIRDGRGTDSLFLAVYTGRNPVPDVFSTT
NQMTVLFITDKSGTQKGFLANFTSGYNLGMPQPCGPNDYQCGSGECIPLANLCDKQWQCK
DGSDEAECVRLFNGSLSINGLVQFRIENNWSTVCADYWSEQILNKVCQLLGLGNMTTSSA
MLSTGNGPFVKITKAANQSLILTPSKQCLSNLVIYLQCNNKPCGKRLITQEISARIVGGS
DAKEGAWPWVVSLFFNEKPICGASLISDEWLVSAAHCVYGRNLIPSQWKGVLGLHTTLNL
TYPQTVIQKIDQIVINPHYNKRTKDSDIAMMHLQFKVNYTDYIQPICLPEASQQFLPGIN
CSVAGWGRTTNQGSTANILQEAEVPLITNEKCQQQMPEYNITENMMCAGYDEGGIDSCQG
DSGGSLMSQDNNRWLLAGVTSFGYQCALPQRPGVYVRVTQFVDWIKQFIR
NT seq 3213 nt NT seq  +upstreamnt  +downstreamnt
atggagcccagtcagattactgtggcagttgtgactgctctaaacaccatgcgtattatc
cagcagtatatgcagaatcagaacaagaacctgcaaaaacagctggaaatgaatctgaaa
aaattgttacctaagagaagtatccctcttagtgactttgaaatctgtcttgttgttttg
cttacaatttttgtgtgtgtttgtgctggattaattgcacttgtatgggtactaagcaag
gagtcgcaacaagtatatggaaacagtcatgcagccacaggaacatttaaaatactttca
ggagcatcattcagccctggtttacaagacaactcatcagctgacttcaaggctcttgcc
tctgatgttcaacaattgataaatgaaatctatcaagcaagtcagctgaagaatgaatat
aagaactctgaagttttgcagttcaaaaatggcagcattatcgtaatattcaacctatac
tttgcacagcgggtatctaatgagaaagcaaagaatgaactcgttttaggaactcaagca
aataaaactagccttttgcagactattaagattgatgtgaacagcatagaaatcacaggt
aactatgaaaattattctacaagcccacctctaacatcatcagaaccactcactacaagc
aagtcttcagcaacaaaaggtgaaattcagttgacatgtttgcctcctgaagaaccttgt
gctgatgccataaactgcataagtaaagacttattttgtgatggagtaccaaactgccca
gatggttcagatgaatctgaaaaaatatgtgctacaacttgtgatggaacatttatgttg
actggctcctctggatctttccactctattaattatccaaagccttataattcaaacatt
gtttgccaatggattatacgtacaaatcaaggattatccattaaactaaacttcacttcc
tttgatacccaacaatatgcggacattttaaatatttatgaaggtacaggaccaagcaag
attttaagagcttcgctctgggggacaaatcctggaacaatttacattttttctgatgag
gctactgcagagtttgttacagattattctgaaaattataatggattcaatgcaacatat
accatttttagtaccagtgagctaagcaataatgaaaaaattaactgcaattttgaagat
ggcttttgttactggattcaaagtttagaagatgatagtgaatgggagagaattagtggg
cctacctttccctttatgtctggccctgattatgatcatacatacggcaatttgtcagga
ttttatatttcaacacccacaggatttacagcaagacaggagagagttcggctttttagc
ttgcctttagttccggcttcagatcaattctgtctaagtttttggtatcacatgtatggt
actaacgtttatcgtttaagtattaacatcatgaatagcagtaacatggaaaagacagtt
ttccagaaagaaggaaattatggaaacaactggaattatggacaagtaacattaaatgaa
acatctgattttaaggttattattgatgcctttaaaaaacaaggtcaaagtgatattgcc
ctggatgacattggcctgataagtggacagtgtaaggaaagcatttatccagaaccaact
ttggttccaacaagcactactccaccttcacttcccactgactgtgggggaccatttgaa
ctctgggaaccaaatactacattcagctctacaaatttcccgaacaactacccacaccaa
gcttcctgtgtgtggtatttaaatgctggaaaaggaaaaaacattcagcttcattttcaa
tattttgagctggaaaatatctatgatgtcgttgaaatccgagatggaagaggaacggat
tccttgtttttagctgtctatacaggacgaaaccccgttccagatgtcttctccaccact
aaccagatgacagtgctcttcattactgacaaatccggaactcagaaaggatttcttgca
aatttcacttctggttataatcttggcatgcctcaaccctgtggacccaatgattatcag
tgtggaagtggggaatgtataccccttgctaacctttgcgacaaacaatggcagtgtaaa
gatggctctgatgaagcagagtgtgtgcgtctgtttaatggttcgctaagcatcaatgga
ttggtacagttcaggattgagaataattggtctacagtatgtgcagattactggagtgag
cagattctaaacaaagtttgtcagctgctaggactaggaaatatgactacatcatcagca
atgttatccactggaaatgggccatttgtaaaaatcaccaaagcagctaaccagagccta
atacttacaccaagcaaacagtgtctcagtaatctggtgatttatctacaatgcaacaat
aaaccttgcggaaaacgactcataactcaggagatcagtgcaaggattgtaggtggaagt
gatgccaaagaaggagcttggccttgggtagtctcactgttttttaatgaaaaacctata
tgtggagcttccctcatcagtgatgaatggctagtctcagcagcgcactgtgtatatggg
aggaatttaataccatctcagtggaaaggagtgctcggcttgcataccactttgaatctc
acatatcctcagacagtaattcaaaagatcgatcaaattgtcataaatcctcattataac
aagcgcacaaaagatagcgacattgctatgatgcatcttcaattcaaagtgaattataca
gattacatacagcctatttgcttaccagaagcaagtcaacagtttttgccaggaattaat
tgctctgttgctggctggggtagaactacaaatcaaggttccactgcaaacatattgcaa
gaagcagaggtccctcttataacaaatgagaaatgccaacaacagatgccagaatataat
attacagagaatatgatgtgtgcaggctatgatgaaggaggaatagattcctgtcaggga
gattcaggagggtccctgatgagtcaagacaataacaggtggcttttggcaggtgtgaca
tcctttggctatcaatgtgcattgccccagcgtcctggagtgtacgttcgagtcacacaa
tttgtggactggataaaacaattcatacgttag

DBGET integrated database retrieval system