KEGG   Chelonia mydas (green sea turtle): 102941758Help
Entry
102941758         CDS       T02989                                 

Gene name
PIK3C2G
Definition
(RefSeq) phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 gamma
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy00562  Inositol phosphate metabolism
cmy01100  Metabolic pathways
cmy04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102941758 (PIK3C2G)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    102941758 (PIK3C2G)
Enzymes [BR:cmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     102941758 (PIK3C2G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_C2 PX C2 PI3K_rbd DUF4135
Motif
Other DBs
NCBI-GeneID: 102941758
NCBI-ProteinID: XP_007071263
Position
Un
AA seq 1495 aa AA seqDB search
MAYFWKMPLTQDELHEGQSEDQASSFMYHFNPDSQVSLGLDQIVGEGSSEIPFYGPAYSH
DLEEKEFFSDAADEHLYGVNPPQIPHRDLYFGSSTSHWQQVRVPPTIGFRPSLLSGCSDL
SVENSYPTYPIGTLYDYDPYGRNNLSPTADEFGSDVEKENKNLNFYIGFEHIDYQHPVFS
DDNASGQGMKDKRRNDSKTCLVSSGETYLTNPPRELTTGPVWPSISANSSADSTELADWS
IQLVEADQGSNESIASFCNGVQKIRDAYPAFDLKTNTGKIWSVTTTLSDEILCKSKFKVS
ILTNCSSPPLHLTPCASCIVRNLIVEILHCTNQYPAQEECFLSVYGSDEFLQNDHALGSH
ESLRKATTSIQIRLQKDTSYQQSLARSHEDDQSQFNVNQLLQYTYIWKVSRKNLVTFIMK
YGGQVEYLLQNEHKVDKVIEEAKAICSFLCSVETRAITDAVKKLRSVPLGKTQNSLQNVE
TPVRVLIENAVAELSTAISHLIHVFSSSFHTDFRPAKILRSPSCADVDLDPHFSFSVYAA
HNIPAAWLKSYKLFSFSCSLTYAGKKICQEKNCKNMPVKKSFFFLANWNEKINFPLQIKS
LPNETILTIKLFGVNCVSKNTEILAWTCSPLYQKQKFNHGTVLLSMALYSEPPTTMIAPG
ICDTSLPALVTLQIDFPETNLEFIKPEPEEKRDDLEEPAKECLKHIAKLSQKHSLLLLSE
QERRFLWFYRSYCNNENCSLPLVLGSAPSWDRKSISEMYMVLREWIFSNPLEALGLLTFS
FPDQDIRRTAVQQMENLSNDELLEYLPQLVQVIKFEWSLESPLVKLLLCRSLQSIQVTHQ
LYWLLKDAQNEAHFKSWYQKLLAAVQFCTGKTLSDEFSKERKLIKILGDVAEKVKAASDP
KKQEVLKMEINKLNQFFHEVNVCRLPLNPALVVRGIDADACSYFTSNAFPLKISFINTDT
LSRNINVIFKVGDDLRQDMLVLQIIRVMDRIWLQEGLDMQMIIYKCLSTGKGQGLVQMVS
DATTLAKIHRESGLIGPLKENTIKKWFSHHHPLESSYQEAIKNFFHSCAGWCVVTFILGV
CDRHNDNIMLTNTGHMFHIDFGKILGHAQKFGSIKRDRAPFIFTSEMEYFITEGGKNPQR
FQEFVELCCRAYNIVRKHSQLLLNLLEMMLHAGLPELNSIQDLKYVYDNLRPQDSDLQAT
SHFTRKIKESLECFPVKLNNLIHTLAQMLATGFAKSTASQNVPQESNLLDAERSIARATI
LGFSKKPDSLYLVQVVQTCQVVTFVEKSFEQFSKLHSHLQKQFPSHALPEFPHWWHLPFT
ELEHKRMKDLNLYVKQLLNGFNNLSNNEHVLSFFLDGSKTDWPEESALVSLGPKSTEQKP
GVQLVISYECTHLTILLKHMRNIHLPDGSVPTAHAEFYLLPDPDEVSRRKTKAVPKSTDP
TYNEIVVYDAVTELQGRVLQLIVKSKGTFVGAINIQLNSVPLNEEKWYPLGNSII
NT seq 4488 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacttctggaaaatgcctttgacacaagatgagttacacgaaggacaatctgag
gaccaagcgtcttcctttatgtatcattttaatcctgatagccaggtcagcctaggactt
gaccaaatagttggtgaaggcagcagtgaaatacccttttatggtccagcatattcacat
gaccttgaagaaaaggagtttttctcagatgcagcagacgaacatttatacggagtaaat
ccacctcaaattcctcatagggacctttactttggaagctccacctctcactggcagcaa
gtcagggtgccaccaacaattggcttcagaccttctttgctatccggatgtagtgacctc
tccgttgagaattcctaccccacataccccattggaacgctttatgactatgatccatat
ggaagaaataacttgagtccaactgcagatgaatttgggtcagatgtggagaaagagaat
aaaaatctgaatttctatataggctttgaacatatagactatcaacatcccgttttctca
gacgacaatgcaagtggacaaggaatgaaagataaaaggagaaatgacagtaaaacttgc
cttgtgagctctggggaaacatacttaacaaaccctcctagagaattgaccacaggacct
gtctggcccagcatttctgcaaacagctctgcagacagcacagagcttgcagattggtct
atccagctggttgaagcggatcaagggagtaatgaaagtattgcctccttctgcaatgga
gtgcagaaaatcagagatgcatatcctgcttttgatttgaagacaaatactgggaagatt
tggagtgtcacaacaacattatcagatgagatcctctgtaaatcaaaattcaaagttagc
attttgacaaactgttcatctcctccactgcatcttacaccatgtgctagctgtattgtc
cgcaacttaattgtagagattctccattgtacaaatcaatatccagcccaggaagaatgt
tttctaagtgtttatgggtctgatgaatttttgcaaaatgatcatgctttgggcagtcat
gagagtcttcgcaaggcaaccacctccattcagattcgtctacagaaagacaccagctat
cagcaaagtttggctcgatcgcatgaagatgaccaaagtcagtttaatgtgaaccagctg
ctacaatatacatatatttggaaggtgtccaggaagaaccttgttacatttattatgaaa
tatggaggtcaagtggaatatctattgcaaaatgagcataaagtggataaagtgattgaa
gaagcgaaagcaatctgcagctttctctgttctgtggaaaccagggctattactgatgca
gtcaagaaactccgttcagtgccactgggaaaaacacagaattcacttcaaaatgtagaa
actccagtcagagtcttgatagagaatgctgtggcagagctgtctacagccatctcccat
ctcatccatgttttcagcagcagcttccacacagattttcggcctgcaaaaatacttaga
agcccttcatgtgcagatgtcgacctagatccccactttagcttctctgtttatgcagcc
cacaacatcccagcagcctggctgaaaagctacaagctcttctccttttcctgttcttta
acctatgctgggaagaaaatatgtcaagagaagaactgcaaaaatatgccagttaaaaag
tctttttttttcctggcaaactggaatgagaaaatcaactttcctctacaaataaaatct
cttcctaatgaaacaatattgacaataaaactatttggagtaaactgtgtatctaaaaat
acagaaatactggcttggacgtgttcccccttgtatcaaaaacaaaagttcaatcatgga
accgtgctgcttagcatggcattgtacagtgagcctccaacaacgatgatagcgccgggc
atttgtgacactagcctgccagcactagtaacactgcagattgactttccggaaactaat
ttggagtttattaaacctgagcctgaagaaaaaagagatgaccttgaagagccagctaaa
gagtgcttgaagcatatagcaaaactttcacagaaacattctctcttgctgttgtcagag
caagagagaagatttttatggttttatcgttcctactgcaataatgaaaactgttccctt
cctttggtactgggcagtgcccccagttgggatcgaaagagcatatcagaaatgtatatg
gtgttgagggaatggatcttttctaaccctttggaggcacttgggctcctgactttcagt
tttccagatcaagacattcgcagaactgcagtccaacaaatggaaaatctgtcaaatgat
gaattgttggaatacctcccacagctggttcaggtgatcaagtttgagtggagtcttgaa
agcccccttgtgaaactcctgctgtgccgctctctacagagcatccaagtaactcatcaa
ctttactggcttttaaaggatgcacagaatgaagctcatttcaaaagctggtatcagaaa
ctactagctgctgtccaattctgcacaggaaaaaccttaagtgatgagttttctaaggag
aggaaacttatcaaaattctgggagatgttgctgaaaaagtcaaggctgccagcgacccc
aaaaaacaggaggtgctaaagatggaaatcaacaaacttaatcagttcttccatgaggta
aatgtttgccggcttcccctgaatcctgcacttgttgtacgaggcatagatgcagatgca
tgttcatatttcacgtccaatgcttttccattgaaaatctccttcatcaatacagataca
cttagtagaaacatcaatgttatttttaaggttggagatgatctacgtcaggatatgctg
gttctgcagattattcgcgtaatggacagaatttggcttcaggagggactcgatatgcaa
atgatcatttataagtgtttatctacaggaaaaggccaaggacttgtgcagatggtgtca
gatgctacaactctagccaagatccacagggagtctggattgataggaccattgaaggaa
aacacaattaaaaaatggttcagtcatcatcatcctttggaatcaagttaccaagaggca
ataaagaatttctttcattcctgtgctggttggtgcgttgttaccttcattctgggagtc
tgtgaccgacacaatgacaacatcatgctgacaaacactggccacatgttccatatagat
tttggaaagattttaggtcatgcacaaaaatttggaagcataaaaagggaccgagcacct
tttatcttcacttcagagatggagtatttcatcacagaaggtggaaaaaacccacagcgc
ttccaagagtttgtggagctttgctgtcgagcttataatatagtcaggaaacacagccaa
ttgctcttgaacctgctggagatgatgctgcatgcagggttgcctgagctgaacagcatc
caggatctgaagtatgtgtatgataaccttcgtccacaggactcagacctccaagccacg
agccactttaccaggaaaataaaggaaagtttagagtgcttccctgtcaaactcaataat
ctgatccatacgcttgcacaaatgttagccacaggctttgccaagtctacagcttcacag
aatgttcctcaggaatccaacctgctggatgcagagaggtcaattgcccgagcaaccatt
ttagggttcagcaaaaagcctgactctctatatttagtccaggtggtgcaaacctgccag
gtggtcacctttgtggaaaaatcatttgaacaattttcaaaacttcacagccatctacag
aagcaatttccatcccatgccctcccagagtttccccactggtggcatttaccttttaca
gagcttgaacacaaaagaatgaaagacttaaatctctatgtgaagcagttattgaatgga
ttcaacaacctgtctaataatgagcacgtcctcagctttttcctcgatgggtccaaaacc
gactggccagaagaatctgcacttgttagcctaggtccaaaatctactgaacagaaacct
ggagtgcagttagtcatatcctatgagtgcacccacctgacaatattgttgaaacatatg
aggaatattcatctcccagatggctctgtcccaactgcacatgctgaattttatctttta
ccagatcctgatgaagtcagcagaaggaaaacgaaagcagttccaaaaagcactgaccct
acttataatgaaattgtagtatatgacgcagtcaccgagctccaaggacgtgtgttacag
cttattgtgaaaagcaaaggaacatttgtgggagctatcaacattcaactgaacagtgtc
ccattaaatgaagaaaagtggtacccattggggaacagtataatttga

DBGET integrated database retrieval system