KEGG   Chelonia mydas (green sea turtle): 102942172Help
Entry
102942172         CDS       T02989                                 

Gene name
GPX1
Definition
(RefSeq) glutathione peroxidase 1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy00480  Glutathione metabolism
cmy00590  Arachidonic acid metabolism
cmy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102942172 (GPX1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102942172 (GPX1)
Enzymes [BR:cmy01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     102942172 (GPX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 102942172
NCBI-ProteinID: XP_007061839
Position
Un
AA seq 120 aa AA seqDB search
MPRCENATNEEILLSLKHVRPGNGYEPNFTMFEKCDVNGANAHPLFTFLKEALPFPHDDP
MSLMTNPQYIIWSPVCRNDISWNFEKFLIGRDGVPFKRYSRHFETIKIQDDIEKLLQHVP
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgctgtgagaacgctaccaatgaggagattctactttcgttaaagcatgtccgc
cctggcaatggttatgagcccaacttcaccatgtttgagaagtgtgatgtgaacggggca
aatgctcacccactcttcactttcctgaaagaggcactgcctttcccacatgatgatcca
atgtcactgatgaccaacccgcagtacatcatctggtctccagtgtgcaggaatgacatc
tcctggaacttcgagaaattcctcattgggcgtgatggcgtgcctttcaagcgctacagc
aggcacttcgaaacgatcaagatccaagatgatattgaaaagctccttcagcatgtcccg
tag

DBGET integrated database retrieval system