KEGG   Chelonia mydas (green sea turtle): 102942278Help
Entry
102942278         CDS       T02989                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type IV-like
  KO
K05869  calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy04020  Calcium signaling pathway
cmy04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102942278
   04020 Calcium signaling pathway
    102942278
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cmy01001]
    102942278
Enzymes [BR:cmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     102942278
Protein kinases [BR:cmy01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   102942278
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 102942278
NCBI-ProteinID: XP_007072135
Position
Un
AA seq 399 aa AA seqDB search
MPTSKPGAEYWIDGSHRNTALEDFYTMGLELGRGATSVVYSCEEKGTHMQYAAKILKKTI
DKKIVRTEIGVLLRLSHPHIIKLKEIFETPSEIVLILERVTGGELFDRIVERGFYSERDA
AHVVKQILEAVSYLHENGVVHRDLKPENLLYADLSPDAPLKIGDFGLSKIVDEQDTMKTV
CGTPGYCAPEILHGSPYGPEVDMWSVGVITYILLCGFEPFFDPRGDQYMYSRILNCDYEF
VSPWWDEVSLNAKDLVQKLIVLDPQKRLTVHQALEHPWVTGKAAKFAHMDSTQKKLQEFN
ARRKLKAAMKAVVASSRLGNHGHHDSSRNGRTHEGTKESCLAQAAENSCLQDNPDSFSVP
SHPESSATGPSAKAENLKAFQSDCPAAPKVAFNGASCES
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcctacctccaaacctggagcggagtactggattgacgggtcccaccgcaacactgcc
ctggaggacttctacaccatgggcctggaactgggaaggggtgccacttccgtggtctac
agctgtgaagagaaaggaacccacatgcagtatgcagccaaaatcctgaagaagacgatt
gacaaaaagattgtacggacagaaatcggcgtcttactgaggctttcgcacccccacatt
atcaaactgaaggagatcttcgaaacgccctccgagatcgtgctcatacttgaacgagtg
acgggaggagagctctttgacaggattgtagagaggggattctacagtgaaagagatgca
gcccatgtggtcaagcagatcctagaagctgtatcttatttgcatgaaaatggagtcgtc
caccgggatctgaaaccagagaatctcctgtatgcagacctttccccagatgcccctctc
aaaattggtgattttggattgtccaagatagtggacgagcaggacaccatgaagactgtt
tgtggtactccgggatattgcgcgcctgaaattctccatggctctccatatggacccgaa
gtggatatgtggtctgtgggtgtcataacatatatactgctttgtgggtttgaaccattt
tttgatccaagaggggaccagtacatgtacagcaggatactgaactgtgactatgagttt
gtttccccttggtgggatgaagtctccctcaatgccaaggacttggttcaaaaactgata
gtcttggacccacagaagaggctaacagtacatcaagcactggaacacccctgggtcacg
ggcaaagcagctaaatttgctcatatggatagcacacaaaagaaactgcaagagtttaat
gcccggcggaaactgaaggctgcaatgaaagctgtagtcgcttctagccgtctaggtaac
cacgggcatcatgacagctccagaaatggacgtactcacgaaggtaccaaagaatcgtgc
ctggcccaggcagctgagaactcctgtctccaagacaatcctgatagcttttccgtgccc
agccaccccgaatccagcgcaacaggtccctcggcaaaggcagagaacctgaaagctttc
caaagtgattgccctgcagctcccaaggttgcgtttaatggggccagctgtgaaagttaa

DBGET integrated database retrieval system